KEGG   Burkholderia pseudomallei MSHR305: BDL_2275Help
Entry
BDL_2275          CDS       T02756                                 

Gene name
petA
Definition
ubiquinol-cytochrome c reductase, iron-sulfur subunit (EC:1.10.2.2)
Orthology
K00411  
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:bpse00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    BDL_2275 (petA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BDL_2275 (petA)
Enzymes [BR:bpse01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.2  With a cytochrome as acceptor
    1.10.2.2  quinol---cytochrome-c reductase
     BDL_2275 (petA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2651952..2652572
Genome map
AA seq 206 aa AA seqDB search
MRDKEEEHVDSGRRTWLIATSVAGGVGGVATVIPFAASLAPSTKAKAAGAPVEVDIGALK
PGEMLTVPWRGKPVWVLNRTDAMLADVVKADKEVADPQSKSPYSMPLPEYCANEYRSRAD
RKNILVVMAVCTHLGCTPSQRFTPGPQPNLPDDWPGGFLCPCHGSTYDLAGRVFKNKPAP
QNLDVPPYMFTSATTLVIGKDEKGEA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcgagacaaagaagaggaacacgtcgacagcggccgccggacatggctgattgcgaca
tcggttgcgggcggcgttggtggcgtcgcaaccgtgatacctttcgcggcgtcgttggcg
ccgtccaccaaggcaaaggcggccggcgcgcccgtcgaagtcgacatcggcgcgctcaag
cccggcgagatgctcacggtgccgtggcgcggcaagccggtgtgggtgctgaaccgcacc
gatgcgatgctcgccgacgtcgtcaaggcggacaaggaagtcgccgatccgcagtcgaaa
tcgccgtactcgatgccgttgcccgagtattgcgcgaacgaataccggtcgagagccgac
cgcaagaacatcctggtcgtgatggcggtgtgcacgcacctcggctgcacgccgagccag
cgtttcacgcccggaccgcagccgaacctgcccgacgactggccgggcggcttcctctgc
ccgtgccacggttcgacctacgatctcgccggacgggtcttcaagaacaagccggctccg
cagaatctggacgtcccgccatacatgttcacgtcggccacgacgctcgtgatcggcaag
gacgagaaaggagaagcgtaa

DBGET integrated database retrieval system