KEGG   Burkholderia pseudomallei MSHR305: BDL_24Help
Entry
BDL_24            CDS       T02756                                 

Definition
aminotransferase class-V family protein
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:bpse01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpse01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpse00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:bpse00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:21226..22464
Genome map
AA seq 412 aa AA seqDB search
MKPIQKSNKLLNVCYDIRGPVLEHAKRLEDEGHRIIKLNIGNLAPFGFDAPDEIIQDMIR
NLPASSGYSDSKGVFAARKAIMHYTQQKGVHGVGLDDIYIGNGASELIVMATQALLNDGD
EVLLPAPDYPLWTAAVSLSGGTPVHYVCDESNRWMPDPDDIRRKITPNTKALVVINPNNP
TGALYSDALLVELIAIAREHGLIIFADEVYDKIVYDGKSHTALASLAEDVITVTFNSLSK
SYRSCGYRAGWMSVAGLTAENRRRAHDYLEGLGILSSMRLCANVPGQYAIQTALGGYQSI
NELIMPSGRLYKQRELAYDMLTSIPGVSCVKPEAALYMFPRLDPKLYPIENDQQFILELL
LRERVLLVQGTGFNWPTPDHFRVVFLPNVDDLTDSIERIARFLDGYRKRNSV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgattcagaagtcgaacaagctgctcaatgtctgctacgacatccgcggcccc
gtcctcgagcacgcgaagcgcctcgaggacgaggggcatcgcatcatcaagctgaacatc
ggcaacctggcgccgttcggtttcgacgcgccggacgagatcatccaggacatgatccgc
aacctgccggcgtcctccggctattcggattcgaaaggcgtgttcgccgcgcgcaaggcg
atcatgcactacacgcagcaaaagggcgtgcacggcgtcgggctcgacgacatctacatc
ggcaacggcgcgtccgagctcatcgtgatggcgacgcaggcgttgctgaacgacggcgac
gaggtgctgctgcccgcgcccgactatccgctctggacggcggccgtgagcctgtcgggc
ggcacgcccgtgcactacgtctgcgacgagtcgaaccgctggatgcccgaccccgacgac
attcgccgcaagatcacgccgaacacgaaggcgctcgtcgtgatcaacccgaacaacccg
acgggcgcgctttattccgacgcattgctcgtcgagttgatcgcgatcgcgcgcgagcac
gggctcatcatcttcgccgacgaggtctacgacaagatcgtctacgacggcaagtcgcac
accgcgctcgcgtcgctcgccgaggacgtgatcaccgtcacgttcaacagcctgtcgaag
agctaccggtcgtgcggctatcgcgcgggctggatgtcggtcgcggggctcacggccgag
aaccgccgccgcgcgcacgattacctggaggggctcggcatcctgtcgtcgatgcgcctt
tgcgcgaacgtgcccggccagtacgcgatccagaccgcgctcggcggctatcagagcatc
aacgagctgatcatgccgagcgggcgcctgtacaagcagcgcgagctcgcgtacgacatg
ctgacgtcgattcccggcgtgtcgtgcgtgaagccggaagcggcgctctacatgtttccg
cgcctcgatccgaagctctacccgatcgagaacgaccagcagttcatcctcgagctgctg
ctgcgggagcgcgtgctgctcgtgcagggcacgggcttcaactggccgacgccggaccac
ttccgcgtcgtgttcctgccgaacgtcgacgacctgaccgattcgatcgagcggatcgca
cgctttctcgacggctaccggaagcgcaactcggtctga

DBGET integrated database retrieval system