KEGG   Burkholderia pseudomallei MSHR305: BDL_24Help
Entry
BDL_24            CDS       T02756                                 

Definition
aminotransferase class-V family protein
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpse00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    BDL_24
   01230 Biosynthesis of amino acids
    BDL_24
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BDL_24
   00290 Valine, leucine and isoleucine biosynthesis
    BDL_24
Enzymes [BR:bpse01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BDL_24
    2.6.1.66  valine---pyruvate transaminase
     BDL_24
Amino acid related enzymes [BR:bpse01007]
 Aminotransferase (transaminase)
  Class I
   BDL_24
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:21226..22464
Genome map
AA seq 412 aa AA seqDB search
MKPIQKSNKLLNVCYDIRGPVLEHAKRLEDEGHRIIKLNIGNLAPFGFDAPDEIIQDMIR
NLPASSGYSDSKGVFAARKAIMHYTQQKGVHGVGLDDIYIGNGASELIVMATQALLNDGD
EVLLPAPDYPLWTAAVSLSGGTPVHYVCDESNRWMPDPDDIRRKITPNTKALVVINPNNP
TGALYSDALLVELIAIAREHGLIIFADEVYDKIVYDGKSHTALASLAEDVITVTFNSLSK
SYRSCGYRAGWMSVAGLTAENRRRAHDYLEGLGILSSMRLCANVPGQYAIQTALGGYQSI
NELIMPSGRLYKQRELAYDMLTSIPGVSCVKPEAALYMFPRLDPKLYPIENDQQFILELL
LRERVLLVQGTGFNWPTPDHFRVVFLPNVDDLTDSIERIARFLDGYRKRNSV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgattcagaagtcgaacaagctgctcaatgtctgctacgacatccgcggcccc
gtcctcgagcacgcgaagcgcctcgaggacgaggggcatcgcatcatcaagctgaacatc
ggcaacctggcgccgttcggtttcgacgcgccggacgagatcatccaggacatgatccgc
aacctgccggcgtcctccggctattcggattcgaaaggcgtgttcgccgcgcgcaaggcg
atcatgcactacacgcagcaaaagggcgtgcacggcgtcgggctcgacgacatctacatc
ggcaacggcgcgtccgagctcatcgtgatggcgacgcaggcgttgctgaacgacggcgac
gaggtgctgctgcccgcgcccgactatccgctctggacggcggccgtgagcctgtcgggc
ggcacgcccgtgcactacgtctgcgacgagtcgaaccgctggatgcccgaccccgacgac
attcgccgcaagatcacgccgaacacgaaggcgctcgtcgtgatcaacccgaacaacccg
acgggcgcgctttattccgacgcattgctcgtcgagttgatcgcgatcgcgcgcgagcac
gggctcatcatcttcgccgacgaggtctacgacaagatcgtctacgacggcaagtcgcac
accgcgctcgcgtcgctcgccgaggacgtgatcaccgtcacgttcaacagcctgtcgaag
agctaccggtcgtgcggctatcgcgcgggctggatgtcggtcgcggggctcacggccgag
aaccgccgccgcgcgcacgattacctggaggggctcggcatcctgtcgtcgatgcgcctt
tgcgcgaacgtgcccggccagtacgcgatccagaccgcgctcggcggctatcagagcatc
aacgagctgatcatgccgagcgggcgcctgtacaagcagcgcgagctcgcgtacgacatg
ctgacgtcgattcccggcgtgtcgtgcgtgaagccggaagcggcgctctacatgtttccg
cgcctcgatccgaagctctacccgatcgagaacgaccagcagttcatcctcgagctgctg
ctgcgggagcgcgtgctgctcgtgcagggcacgggcttcaactggccgacgccggaccac
ttccgcgtcgtgttcctgccgaacgtcgacgacctgaccgattcgatcgagcggatcgca
cgctttctcgacggctaccggaagcgcaactcggtctga

DBGET integrated database retrieval system