KEGG   Burkholderia pseudomallei MSHR305: BDL_2515Help
Entry
BDL_2515          CDS       T02756                                 

Definition
glu/Leu/Phe/Val dehydrogenase, dimerization domain protein
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpse00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BDL_2515
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BDL_2515
   00330 Arginine and proline metabolism
    BDL_2515
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BDL_2515
Enzymes [BR:bpse01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     BDL_2515
Exosome [BR:bpse04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BDL_2515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2915898..2917202
Genome map
AA seq 434 aa AA seqDB search
MSSQSQSPSVAQSIPSYLHADDLGPWGNYLQQVDRVAPYLGSLSRWIETLKRPKRILIVD
VPIELDNGTVAHFEGYRVQHNVSRGPGKGGVRYHQDVTLSEVMALSAWMSVKNAAVNVPY
GGAKGGIRVDPRKLSRGELERVTRRYTSEIGIIIGPNTDIPAPDVNTNEQIMAWMMDTYS
MNQGQTATGVVTGKPISLGGSLGRKEATGRGVFVVGCEAAKKKGLEIEGARIAVQGFGNV
GGIAAKLFQEAGAKVIAVQDHTGTIHQPAGVDTVKLLEHVGRTGGVAGFEGAEPMPNDEF
WTVETDILIPAALENQITEKNASKIRTKIIVEGANGPTTTAADDILSANGVLVIPDVIAN
AGGVTVSYFEWVQDFSSFFWTEDEINHRLERVMREAFAGVWAVAEEHNVSVRTAAFIVAC
KRILMAREMRGLYP
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgcaatcgcagtccccgtccgtcgcgcagtccattccgtcgtacctgcacgcg
gacgatctcggcccctggggcaactatctgcagcaagtcgatcgcgtcgcgccgtatctc
ggctcgctgtcgcgctggatcgagacgctcaagcgcccgaaacgcatcctgatcgtcgac
gtgccgatcgagctggacaacggcaccgtcgcgcacttcgagggctatcgcgtgcagcac
aacgtgtcgcgcggcccgggcaagggcggcgtgcgctaccaccaggacgtgacgctgtcc
gaggtgatggcgctgtccgcatggatgtcggtgaagaacgcggccgtgaacgtgccgtac
ggcggcgcgaagggcggtatccgcgtcgatccgcgcaagctctcgcgcggcgagctcgag
cgcgtgacgcgccgctacacgagcgaaatcggcatcatcatcggcccgaacaccgatatc
cccgcgcctgacgtcaacacgaacgagcagatcatggcgtggatgatggacacgtactcg
atgaaccagggccagacggcgacgggcgtcgtgaccggcaagccgatctcgctcggcggc
tcgctcggccgcaaggaagcgacgggccgcggcgtgttcgtcgtcggctgcgaggcggcg
aagaagaaggggctcgagatcgaaggcgcgcgcatcgcggtccagggcttcggcaatgtc
ggcgggatcgccgcgaagctgttccaggaagcgggcgcgaaggtgatcgcggtgcaggat
cacacgggcacgattcaccagccggcgggcgtcgatacggtcaagctgctcgagcacgtc
ggccgcacgggcggcgtcgcgggcttcgaaggcgcggaaccgatgccgaacgacgagttc
tggaccgtcgaaaccgatatcctgattccggccgcgctggaaaaccagatcaccgagaag
aacgcgtcgaagatccgcacgaagatcatcgtcgagggcgcgaacggcccgacgacgacg
gccgcggacgatatcctgagcgcgaacggcgtgctcgtgatccccgacgtgatcgcgaac
gcgggcggcgtgaccgtgtcgtacttcgaatgggtgcaggatttctcgagcttcttctgg
acggaggacgagatcaatcaccgtctcgagcgcgtgatgcgcgaggcgttcgccggcgta
tgggcggtggccgaagagcacaacgtgtcggtgcgcacggcggcgttcatcgtcgcatgc
aagcgcatcctgatggcgcgcgaaatgcgcggtctgtacccctga

DBGET integrated database retrieval system