KEGG   Burkholderia pseudomallei MSHR305: BDL_3773Help
Entry
BDL_3773          CDS       T02756                                 

Gene name
fdhA
Definition
formaldehyde dehydrogenase, glutathione-independent (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDL_3773 (fdhA)
  Energy metabolism
   00680 Methane metabolism
    BDL_3773 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BDL_3773 (fdhA)
Enzymes [BR:bpse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BDL_3773 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:309382..310581
Genome map
AA seq 399 aa AA seqDB search
MSSNRGVVYQGPGKVEVRKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVIEVGRDVETLKIGDLVSVPFNVACGRCAMCKEQHTGVCLNVNPARA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDRAMAKIRDLTCLSDILPTGYHGAV
TAGVKPGSTVYVAGAGPVGMAAAASARLLGAACTIVGDMNAERLAHAKAMGFEVVDLSKD
ATLGEQIEQILGKPEIDCAVDCVGFEAHGHGSSGHAQEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAVDVAAKHGSLSIRFGLGWAKSHSFHTGQTPVLKYSRNLMQAILFDRLPIA
EIVNVAVISLDDAPEGYKKFDGGAPRKFVIDPHGMLKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaccgaggtgtcgtgtatcaggggccgggcaaggtcgaagtgcggaagatc
gactatccgaagatggtcgatccgagcggccgcgcgatcggccacggcgtgatcctgaag
gtcgtcagcacgaatatctgcggctccgatcagcacatggtgcgcggccgcacgacggcg
cccgtcggtctcgtgctcggccacgagatcacgggcgaggtgatcgaggtcggccgcgat
gtcgagacgctgaagatcggcgatctcgtatcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggagcagcacacgggcgtgtgcctgaacgtgaatccggcgcgcgcg
ggcggcgcgtacggctatgtcgacatgggcggctggatcggcgggcaagccgaatacgtg
ctcgtgccgtacgccgacttcaacctgctgaaattccccgatcgcgatcgggccatggcg
aagatccgcgatctcacgtgcctgtcggacatcctgccgaccggctatcacggcgcggtc
acggccggcgtgaagcccggctcgacggtttacgtcgcgggcgcgggcccggtggggatg
gcggccgccgcgtcggcgcggctgctcggcgccgcatgcacgatcgtcggcgacatgaac
gccgagcgcctcgcgcacgcgaaggcgatgggcttcgaggtggtcgatctgtcgaaggac
gcgacgctcggcgagcagatcgagcaaatcctcggcaagccggagatcgattgcgcggtt
gactgcgtcggcttcgaggcgcacggccacggctcgtccggccatgcgcaggaggcgccc
gcgacggtgctgaactcgctgatggaaatcacccggcccgcgggcgcgatcggcattccg
ggcctgtacgtgaccgacgatccgggcgccgtcgatgtcgccgccaagcacggcagcctg
agcattcgtttcggtctcggctgggcgaaatcgcattcgttccataccggccagacgccc
gtgctcaagtacagccgcaacctgatgcaggcgatcctgttcgaccggctgccgatcgcg
gaaatcgtcaacgtggcggtgatttcgctcgacgacgcgccggagggctacaagaagttc
gacggcggcgcgccgcgcaaattcgtcatcgatccgcacgggatgctgaaggcggcctga

DBGET integrated database retrieval system