KEGG   Burkholderia pseudomallei MSHR305: BDL_3950Help
Entry
BDL_3950          CDS       T02756                                 

Definition
alpha/beta hydrolase fold family protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bpse  Burkholderia pseudomallei MSHR305
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(527289..528104)
Genome map
AA seq 271 aa AA seqDB search
MTGRTGILLIHGLGGTQYDLGSLHKAMRRAGGDTHMITLPGHGTRPEDLVDVRAEAWLDA
VTAQYRALEREYDTVHVAGMCMGALVALLLCRRVRHARGRLALLAAPMFIDGWSTPWYRS
LRHLLYRVPGVPARLRVDEDEPFGIKNPTIRAIVKKKFERQDNFHYPWVPLACIRQVDRL
RSWARAAAADTHCPTLVLHAREDELTSLRSADFLLKHLPDARGIVLENSYHMICADNDRD
EVARQVLTFFGFDPSHAMSPAMARRMGRADP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccgaacgggcattctgctgatccacgggctcggcgggacgcagtacgatctc
ggctcgctgcacaaggcgatgcgccgggcgggcggcgacacgcacatgatcacgctgccg
gggcacggcacgcgccccgaggatctcgtcgacgtgcgcgcggaagcgtggctcgacgcg
gtcaccgcgcagtatcgcgcgctcgagcgcgagtacgacaccgtgcatgtcgcgggcatg
tgcatgggcgcgctcgtcgcgctgctgctgtgccggcgcgtgcggcacgcgcgcgggcgg
ctcgcgctgttggccgcgccgatgttcatcgacggctggtcgacgccctggtaccgatcg
ctgcgacatctgctgtaccgcgtgcccggcgtgccggcgcggctgcgcgtcgacgaggac
gagccgttcggcatcaagaacccgacgattcgcgcgatcgtgaagaagaagttcgagcgt
caggacaacttccactatccgtgggtgccgcttgcatgcatccgccaggtcgatcgcctg
cgaagctgggcgcgcgcggcggcggccgacacgcactgcccgacgctcgtgctgcatgcg
cgcgaggacgagctcacgagcctgcgctcggcggacttcctgctgaagcacctgcccgac
gcgcgcgggatcgtgctggagaacagctaccacatgatctgcgcggacaacgatcgcgac
gaagtcgcccggcaggtgctgacgtttttcggcttcgatccgtcgcatgcgatgagcccg
gcgatggcgcgccggatggggcgcgccgatccgtga

DBGET integrated database retrieval system