KEGG   Burkholderia pseudomallei MSHR305: BDL_4932Help
Entry
BDL_4932          CDS       T02756                                 

Definition
glycosyl hydrolases 8 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpse00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BDL_4932
Enzymes [BR:bpse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BDL_4932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1796396..1797937)
Genome map
AA seq 513 aa AA seqDB search
MARQAGRDEGVGRIGRIGREAGDAREVAGAGEACGRRHARADAWARRASRASRGWRTFWR
GRGGVRAVVASVVASFSVMAFAAATLPVSWRVAAAAERTRSGGERAGGLRDTAGLIEISA
AAAASTPIPAAPRRFAQPFAQTFAQPARAFAVASACAPSWPRWDRFKRDFVSADGRVIDV
GSADERTVSEGQAYGLFFALVANDRAAFDALLRWTEDNLAQGDLSARLPAWLWGRAADGA
WRVLDANAASDADLWLAYALLEAGRLWRERSYTARGALLAKRVLDEETATLPGLGLVLLP
GPTGFRPARDAWRLNPSYSPPQAIRGIGAHVPDDARWARLAAGVGRVLTDSAPRGFAPDW
ALYRAGRGFEPDAETHAASAYNAIRVYLWAGMLDAGDPLARPLVAHFAPFAEHVAAHGAP
PEAVDATTGAAAPRDGNAGFSAAAVPFLEARGERASADAQLARVARLERETASGYYANVL
TLFGLGWRDGRYRFAADGTLRVRWSEPCSTPAR
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcaagcggggcgagacgaaggcgtcgggcgcatcgggcgcatcgggcgtgaa
gcgggcgacgcgcgcgaggtggccggggcgggcgaggcgtgcgggaggcgccacgcgcgg
gccgacgcgtgggcgcggcgggcgtcgcgagcatcgcgtgggtggcgcacgttttggcgc
gggcgcgggggcgtgcgcgccgtcgtggcgagcgtcgtggcgagcttctcggtgatggcg
ttcgcggcggcgacgttgccggtgtcgtggcgcgtcgccgcggcggcggagcgcacgcga
agcggcggcgaacgcgcgggcgggctgcgcgacacggcgggcttgatcgagatctcggcg
gcggcggcggcctcgacgccgatcccggcggcgccgcggcggttcgcgcagccgttcgcg
cagacgttcgcgcagccggctcgcgcgttcgccgtcgcgagcgcctgcgcgccgtcctgg
ccgcgctgggaccgtttcaagcgtgacttcgtatcggccgacggccgcgtgatcgacgtc
ggctcggccgacgagcggaccgtatccgaggggcaggcgtacggccttttcttcgcgctc
gtcgcgaacgaccgcgcggcgttcgacgcgctgctgcgctggaccgaggacaatctcgcg
cagggcgatctgagcgcgcgtctgcccgcgtggctgtggggccgcgcggccgacggcgcg
tggcgcgtgctcgatgcgaacgccgcgtccgacgccgatctgtggcttgcgtacgcgctg
ctcgaagcggggcgcttgtggcgcgagcgcagctacacggcgcgcggcgcgttgctcgca
aagcgcgtgctcgacgaggagaccgcgacgctgccggggctcggtctcgtgctgctgccg
ggcccgacgggttttcggccggcgcgcgacgcgtggcggctgaatccgagctattcgccg
ccgcaggcgattcgcgggatcggtgcgcatgtgcccgacgacgcgcgctgggcgcggctc
gcggcgggcgtcggccgcgtgctgaccgacagcgcgccgcgcggcttcgcgccggactgg
gcgctgtatcgcgcgggccgcggcttcgagccggacgccgaaacgcatgcggcgagcgcg
tacaacgcgattcgcgtctatctgtgggcgggcatgctcgatgcaggcgatccgttggcg
cggccgctcgtcgcgcatttcgcgccgttcgccgagcatgtcgccgcgcatggcgcgccg
ccggaggcggtcgatgcgacgacgggcgcggccgccccgcgcgacggcaatgccgggttt
tccgcggcggctgtgccgtttctcgaggcgcgcggcgagcgggcgagcgccgacgcgcag
ctcgcgcgcgtcgcgcggctcgagcgcgagacggcgagcggctattacgcgaacgtgctg
acgctgttcgggctcggctggcgcgacgggcgctaccggttcgcggccgacggcacgctg
cgggtgcgatggagcgagccgtgctcgacgcccgcgcgttga

DBGET integrated database retrieval system