KEGG   Burkholderia pseudomallei MSHR305: BDL_5463Help
Entry
BDL_5463          CDS       T02756                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bpse01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bpse01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2461081..2462121
Genome map
AA seq 346 aa AA seqDB search
MKHASAESPDSAGCAETPARAPAGSAADTAAPPAPDERASGHLSRASSARHLGVAALPAA
GTAAAIALWAGFGLAPRVQDIAMLAVFYVLNILGMELALHRYFAHRTFKAKPAVKIALAI
LGSLAYMGPLMWWVAIHRLHHANADRPGDPHTPQLGGRGFAGRAKGILHGHVGWLFDPSS
ARPKGWNQYANDMYRDPTLLRIHLAYDYWLLLGLLLPAALGWLLDPSWRGALLGLLWGGT
VRIFLATNAIWAVNSIGHALGGRRPFPGRDQSRNAAWLAFVTLGAGWHNNHHAFPQYAST
RLTRWQIDVTGMLIALLERLGLVWDVQHPDRDAVRERLANARRDDA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacgcgagcgccgagagccccgatagcgccggctgcgccgagacgccggcgcgc
gcgccggccggctcggcggcggatacggccgccccgcccgcgcccgacgagcgcgcctcc
ggccatctgtcgcgcgcgtcgtccgcgcgccatctgggcgtcgcggcgctgcccgccgcc
ggcacggccgccgcgatcgcgctctgggccgggttcggcctcgcgccgcgcgtgcaggac
atcgccatgctcgcggtcttctacgtgctcaacattctcggcatggagctcgcgctgcac
cgctatttcgcgcatcgcacgttcaaggcgaagccggccgtgaagatcgcgctcgcgatc
ctaggctcgctcgcgtacatggggccgctgatgtggtgggtggcgatccaccggctgcat
cacgcgaacgccgaccggccgggcgacccgcacacgccgcaactcggcgggcgcggcttc
gccggccgcgcgaagggcatcctgcacgggcacgtcggctggctgttcgatccgtcgtcc
gcgcgcccgaagggctggaaccagtatgcgaacgacatgtaccgcgacccgacgctgctg
cgcatccatctcgcgtacgactactggctgctgctcggcctgctgctgccggccgcgctc
ggctggctgctcgatccttcgtggcggggcgcgctgctcggcctgctgtggggcggcacc
gtgcggatctttctcgcgacgaacgcgatctgggcggtcaattcgatcggccacgcgctc
ggcggccggcggccgtttcccggccgcgaccagagccgcaacgcggcgtggctcgcgttc
gtcacgctcggcgcgggctggcacaacaaccatcacgcgtttccgcagtatgcgagcacg
cgcctgacccgctggcagatcgacgtgaccggcatgctgatcgcgctgcttgaacggctg
ggcctcgtgtgggacgttcagcacccggaccgggacgcggtgcgcgagcggctcgcgaac
gcacggcgcgacgacgcgtag

DBGET integrated database retrieval system