KEGG   Burkholderia pseudomallei MSHR305: BDL_5482Help
Entry
BDL_5482          CDS       T02756                                 

Gene name
gabT
Definition
4-aminobutyrate transaminase (EC:2.6.1.19)
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpse00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BDL_5482 (gabT)
   00650 Butanoate metabolism
    BDL_5482 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BDL_5482 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BDL_5482 (gabT)
Enzymes [BR:bpse01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BDL_5482 (gabT)
Amino acid related enzymes [BR:bpse01007]
 Aminotransferase (transaminase)
  Class III
   BDL_5482 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2478149..2479435
Genome map
AA seq 428 aa AA seqDB search
MTNQDLQSRKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFASGIAVNNVGHRHPK
VVAAIRQQLDEGFIHTAYQIVPYASYVELAEKINRLSPGSQRKKTAFFTTGAEAVENAIK
IARAATGRSGVIAFNGGFHGRTMMGMALTGKVAPYKIGFGPFPAEIYHAPYPCELHGITV
QAALAGIDQRFKSDIDPQRVAAFIFEPVQGEGGFHMAPPEFVRGLRALCDQYGILLIADE
IQTGFARTGKLFAMQHYDVDADLMTIAKSLAGGMPLSGVVGRADLMDAAQPGGLGGTYAG
NPLAIAAAHAVLDVIAHGNLPARATELGAQLKARLARIRRDVPQLAEVRGPGAMIAVEFI
DPKTGAPDPAFTKGVQTQALGRGLILLICGVHSNVIRFLFPLTIQQDVFEEGVRILEDVL
LAGATTQA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccaggacctgcagtcccgcaaaaatgcagcgacgccgcgcggcgtcggcgtg
atgtgcgacttctacgctgcgcgggccgaaaacgctgagttatgggacgtggaaggacgg
cgcttcatcgatttcgcgagcggcatcgccgtcaataacgttgggcaccgtcatccgaag
gtcgttgctgcgatccgccagcagctcgacgaagggttcatccataccgcataccagatt
gtcccgtacgcctcgtacgtcgaactcgccgagaagatcaaccggctttcaccgggttcg
caacggaaaaagaccgcgttcttcacgactggtgccgaagccgtcgaaaacgccatcaag
atcgcccgagccgcaactggccgttcgggcgtgatcgcattcaacggcggcttccatggc
cgcacgatgatgggcatggcgctgaccggaaaggtcgctccgtacaagatcggtttcggg
ccgttcccggcagagatctatcacgcaccctatccgtgtgaattgcatggcatcaccgtt
caagctgcgctagcaggcattgatcagcgcttcaagtccgacatcgatccgcagcgcgtc
gccgcctttatcttcgaaccggtgcaaggcgaaggtggtttccacatggcgccaccggaa
ttcgtgcgcgggcttcgcgcgctatgtgaccagtacggcatcctgctgattgctgatgaa
atccaaaccggtttcgcccgcacgggtaagctgttcgcgatgcagcactatgacgtcgac
gcggacctgatgaccatcgcaaagagccttgcgggcggcatgccgctgtccggggtggtg
ggtcgcgcggacctgatggacgccgcacagccgggcggtcttggtggcacgtatgccgga
aatccgctggccattgcggcggcgcatgcggtgcttgacgtcatcgcccacggcaatctg
ccagcacgcgcaacggaactcggtgcgcagttgaaggcccggttggcgcggatcaggcga
gacgtaccgcagcttgccgaagtacgaggtcccggcgcgatgattgcggtcgagttcatc
gacccgaagaccggagcgcccgatcctgccttcacgaagggcgtgcagacacaagcgctc
ggacgtggactgatcctgctgatttgcggcgtacacagcaacgtcattcgcttcctgttc
ccgttgacgatccagcaggacgtgttcgaagaaggagtcaggattctcgaagatgtcctg
ttggctggtgcgacgacccaagcctaa

DBGET integrated database retrieval system