KEGG   Burkholderia pseudomallei MSHR305: BDL_5686Help
Entry
BDL_5686          CDS       T02756                                 

Definition
catalase family protein
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpse00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BDL_5686
  Amino acid metabolism
   00380 Tryptophan metabolism
    BDL_5686
Enzymes [BR:bpse01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BDL_5686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2722884..2725010)
Genome map
AA seq 708 aa AA seqDB search
MADSDRNAPHETPRAAQPDDARADRKSQDLEPYRSKPQGEALRTNQGVRIADDQNTLRAG
ARGPSLLEDFIMREKITHFDHERIPERVVHARGSAAHGVFRVYESMAEYTKAAFLQDPAK
ETPVYVRFSTVQGPRGSADTVRDVRGFAVKFYTDEGNYDLVGNNIPVFFIQDAIKFPDFV
HAVKPEAPNEMPTGASAHDTFWDFVSLVPESAHMVAWLMSDRAIPRSFRTMEGFGVHTFR
FVNAQGVARFVKLHWRPVLGSYSLLWDEAQKIAGHDPDFHRRDLWEAIERGDYPEYELGV
QMIEARDQHAFGFDLLDPTKLIPEETVPVKLIGKMTLNRNPDNFFAETEQVAFHPGHLVP
GIDFTDDPLLQGRLFSYTDTQLSRLGGPNFHELPINRPVCPFANLQRDAMHRQTIDVGQA
SYEPNSLNGGWPKETDPAGRDGGFDSYPETVEGAKVRVRSGSFADHFSQAALFYQSMSDV
ERRHIRDAYRFELGKVTRPEIRARVVDEILARFDAGLAAEVAEGLGLPPPPASAPAIVAQ
PLSPALSLLTRGKRSVRSRKVALVATPGADTRLIERVRRALTDARAVPVLVAPTLARIGE
LTPEATLAGMPSVMFDAVFVCGGDGDGRDLVHSSDARHFLQEAFKHLKAIAAVGSGRQLL
GAAHLPEQGDGVCVGHAADLDQVVAKFFDALSEHRVWSREPLAQGVPA
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggccgattcagaccgcaacgctccacacgaaacgccgcgcgccgcgcagccggacgac
gcgcgcgcggaccgcaaatcgcaggatctcgagccgtatcgctcgaagccgcaaggcgag
gcgctgcgcacgaaccagggcgtgcgcatcgcggacgatcagaacacgctgcgcgcgggc
gcgcgcggcccgtcgctgctcgaagacttcatcatgcgcgagaagatcacgcatttcgat
cacgagcgcattccggagcgcgtcgtgcacgcgcgcggctcggccgcgcacggcgtgttc
cgcgtctacgaatcgatggccgagtacacgaaggccgcgttcctgcaggacccggcgaag
gaaacgcccgtgtacgtgcgcttctcgacggtgcagggtccgcgcggctccgccgacacg
gtgcgcgacgtgcgcggcttcgccgtgaagttctacaccgacgagggcaactacgatctc
gtgggcaacaacataccggtgttcttcatccaggatgcgatcaagttcccggatttcgtg
cacgcggtgaagccggaggcgcccaacgagatgccgacgggcgcgtccgcgcacgatacg
ttctgggatttcgtgtcgctcgtgccggaatccgcgcacatggtcgcgtggctgatgtcg
gaccgcgcgattccgcgcagcttccgcacgatggaaggcttcggcgtgcatacgttccgg
ttcgtcaatgcgcagggcgtcgcgcgcttcgtgaagctgcactggcgcccggtgctcggc
tcgtactcgctgctgtgggacgaggcgcagaagatcgccggccacgatccggatttccac
cggcgggatttgtgggaggcgatcgagcgcggcgactatccggagtacgaactcggcgtg
cagatgatcgaggcgcgcgaccagcacgcgttcggcttcgatctgctcgatccgaccaag
ctgattccggaggaaacggtgccggtgaagctgatcggcaagatgacgctcaatcgcaat
ccggacaatttcttcgcggaaaccgagcaggtggcgtttcatccggggcacctcgtgccg
ggcatcgatttcaccgacgatccgctgctgcagggccggctcttctcgtacaccgacacg
caactgagccgtctcggcgggccgaacttccacgagctcccgatcaaccggccggtgtgc
ccgttcgcgaatctgcagcgcgacgcgatgcaccggcagacgatcgacgtcgggcaggcg
tcgtacgagccgaattcgctgaacggcggctggccgaaggaaaccgatcccgccgggcgg
gacggcggcttcgacagctacccggagacggtcgagggcgcgaaggtgcgcgtgcgcagc
ggatcgttcgccgatcatttctcgcaggccgcgctgttctatcagagcatgagcgacgtc
gagcggcggcacatccgcgatgcataccgcttcgagctcggcaaggtgacgcggcccgag
attcgcgcgcgcgtcgtcgacgagatcctcgcgcgcttcgatgcgggcctcgccgcggaa
gtggccgaggggctcggtttgccgccgccgcccgcgagcgcgccggcgatcgtcgcgcag
ccgctgtcgcccgcgctcagcctgctcacgcgcggcaagcgcagcgtgcgctcgcgcaag
gtcgcgctcgtcgcgacgccgggcgcggacacgcgcctcatcgagcgcgtgcggcgcgcg
ctgaccgatgcgcgcgcggtgccggtgctcgtcgcgccgacgctcgcgcggatcggcgaa
ctcacgcccgaggcgacgctcgccggcatgccgtcggtgatgttcgacgcggtgttcgtc
tgcggcggcgacggcgacgggcgcgacctcgtgcattcgagcgacgcgcggcatttcctg
caggaggcgttcaagcacctgaaggcgatcgccgccgtgggctccgggcgtcagctgctc
ggcgccgcgcatctgccggagcagggggacggcgtgtgcgtcgggcacgcggcggatctc
gatcaggtggtcgcgaagttcttcgacgcgttgtccgagcaccgcgtctggtcgcgcgag
ccgctcgcgcagggcgtgcccgcgtag

DBGET integrated database retrieval system