KEGG   Burkholderia pseudomallei MSHR146: BBN_1820Help
Entry
BBN_1820          CDS       T03024                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BBN_1820 (rbsK)
Enzymes [BR:bpsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BBN_1820 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1:complement(2109771..2110664)
Genome map
AA seq 297 aa AA seqDB search
MDLVVRSARLPRPGETLAGRSFAQAAGGKGGNQAVAAARLGAQVAMLGRVGADAHGAALR
AGLVAEGIDCVALSVSATATTGVALIVVDDASQNAIVIVAGSNGEVTPESIAGHEAAIAA
ADVLICQLETPAAAVRAALAAGRRLGKTVVLNPAPAAGPLPADWLPLVDYLIPNEIEAAA
LTGLPVRDPASAETAARALAAAGARNVIVTLGGQGVLALTADGDARHYPAPRVAPVDTTA
AGDTFIGGFAARLAARDAPHDAIRFAQRAAALSVTRAGAQPSIPTLAELDAFAPGPA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgtcgtgcgctcggcgcggctgccgcggccgggcgagacgctcgccggccgc
tcgttcgcgcaggcggcgggcggcaagggcggcaaccaggcggtcgcggccgcgcggctc
ggcgcgcaggtggcgatgctcggccgcgtcggcgcggacgcgcacggcgccgcgctgcgc
gcggggctcgtcgccgaggggatcgattgcgtcgcgctgtcggtcagcgcgacggcgacg
acgggcgtcgcgctcatcgtcgtcgacgatgcgagccagaacgcgatcgtgatcgtcgcg
ggcagcaacggcgaggtgacccccgaatcgatcgccgggcacgaggcggcgatcgccgcg
gccgacgtgctgatctgccagctcgagacgcccgccgccgcggttcgcgcggcgctggcc
gccggccgccggctcggcaagaccgtcgtgctgaatccggcgcccgctgccggcccgctg
cccgccgactggttgccgctcgtcgattacctgatcccgaacgaaatcgaggccgccgcg
ctgaccggcttgccggtgcgcgacccggcgagcgccgagaccgccgcgcgcgcgcttgcg
gcggctggcgcgcgcaacgtgatcgtcacgctgggcggccagggcgttctcgcgctgacg
gcggacggcgacgcgcgccactacccggcgccgcgcgtcgcgcccgtcgacacgacggcc
gcgggggacacgttcatcggaggtttcgccgcgcggctcgccgcgcgcgacgcgccgcac
gacgcgatccggttcgcgcagcgcgcggctgcgttgtcggtcacgcgcgcgggcgcgcag
ccgtcgattccgacgctcgccgagctcgacgcgttcgcgccggggccggcgtga

DBGET integrated database retrieval system