KEGG   Burkholderia pseudomallei MSHR146: BBN_5515Help
Entry
BBN_5515          CDS       T03024                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BBN_5515
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BBN_5515
Enzymes [BR:bpsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BBN_5515
Lipid biosynthesis proteins [BR:bpsu01004]
 Desaturase
  First
   BBN_5515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2:2567631..2568671
Genome map
AA seq 346 aa AA seqDB search
MKHASAESPDSAGCAETPARAPAGSAADTAAPPAPDERASGHLSRASSARHLGVAALPAA
GTAAAIALWAGFGLAPRVQDIAMLAVFYVLNILGMELALHRYFAHRTFKAKPAVKIALAI
LGSLAYMGPLMWWVAIHRLHHANADRPGDPHTPQLGGRGFAGRAKGILHGHVGWLFDPSS
ARPKGWNQYANDMYRDPTLLRIHLAYDYWLLLGLLLPAALGWLLDPSWRGALLGLLWGGT
VRIFLATNAIWAVNSIGHALGGRRPFPGRDQSRNAAWLAFVTLGAGWHNNHHAFPQYAST
RLTRWQIDVTGMLIALLERLGLVWDVQHPDRDAVRERLANARRDDA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacgcgagcgccgagagccccgatagcgccggctgcgccgagacgccggcgcgc
gcgccggccggctcggcggcggatacggccgccccgcccgcgcccgacgagcgcgcctcc
ggccatctgtcgcgcgcgtcgtccgcgcgccatctgggcgtcgcggcgctgcccgccgcc
ggcacggccgccgcgatcgcgctctgggccgggttcggcctcgcgccgcgcgtgcaggac
atcgccatgctcgcggtcttctacgtgctcaacattctcggcatggagctcgcgctgcac
cgctatttcgcgcatcgcacgttcaaggcgaagccggccgtgaagatcgcgctcgcgatc
ctcggctcgctcgcgtacatggggccgctgatgtggtgggtggcgatccaccggctgcat
cacgcgaacgccgaccggccgggcgacccgcacacgccgcaactcggcgggcgcggcttc
gccggccgcgcgaagggcatcctgcacgggcacgtcggctggctgttcgatccgtcgtcc
gcgcgcccgaagggctggaaccagtatgcgaacgacatgtaccgcgacccgacgctgctg
cgcatccatctcgcgtacgactactggctgctgctcggcctgctgctaccggccgcgctc
ggctggctgctcgatccttcgtggcggggcgcgctgctcggcctgctgtggggcggcacc
gtgcggatctttctcgcgacgaacgcgatctgggcggtcaattcgatcggccacgcgctc
ggcggccggcggccgtttcccggccgcgaccagagccgcaacgcggcgtggctcgcgttc
gtcacgctcggcgcgggctggcacaacaaccatcacgcgtttccgcagtatgcgagcacg
cgcctgacccgctggcagatcgacgtgaccggcatgctgatcgcgctgctcgaacggctg
ggcctcgtgtgggacgttcagcacccggaccgggacgcggtgcgcgagcggctcgcgaac
gcacggcgcgacgacgcgtag

DBGET integrated database retrieval system