KEGG   Bordetella petrii: Bpet0140Help
Entry
Bpet0140          CDS       T00637                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bpt  Bordetella petrii
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpt00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bpt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(148579..149847)
Genome map
AA seq 422 aa AA seqDB search
MDKLRITGGAQLRGEVTISGAKNSALPILCAGLLTADPLVLANVPDLNDTSTMLRLLGRM
GVRAERGADGIVTVQASQVDNLEAPYDLVKTMRASILVLGPLLARFGQARVSLPGGCTIG
QRPVDQHIKGMAALGADIRIEHGFVVAQAARLKGASIRTDMVTVTGTENLLMAAVLAEGQ
TVLENAAREPEIVDLAELLIKMGARIQGHGTDRIVIDGVASLHGAEHSVIPDRIEAGTFL
CAVGAAGGDITLRNAAPDTLGATLDKLIEAGLTIETGPDWIRGAMQGRPRAVGARTHEYP
GFATDMQAQLMALDTVAQGTAVIVENIFENRYMHVQELRRMGADIDIDGHTAVVRGVPRL
SGAAVMATDLRASASLVIAGLAAEGQTQVDRIYHLDRGYDRMEVKLRALGANIQRLTGKE
PA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacaagctacgcattaccggcggcgcgcagttgcgcggcgaagtcaccatctcgggg
gccaagaactcggccctgcccatcctgtgcgccggcctgctcaccgccgacccgctggtc
ctggccaacgtgcccgacctgaacgacacctctaccatgctgcgcctgctgggccgcatg
ggcgtgcgcgccgagcgcggggccgacggcatcgtcaccgtgcaggccagccaggtcgac
aatctcgaagccccctacgatctggtcaagaccatgcgcgcgtccatcctggtgctgggg
ccgctgctggcgcgcttcggccaggctcgcgtcagcctgccgggcggctgcaccatcggc
cagcgcccggtcgaccagcacatcaagggcatggcggcgctgggcgcggacatccgcatc
gagcatggcttcgtggtggcgcaggccgcgcgcctgaagggcgcctccatccgcaccgac
atggtcacggtcacgggcaccgaaaacctactcatggccgccgtgctggccgagggccag
acggtgctcgaaaacgccgcgcgcgaacctgaaatcgtcgacctggccgaactgctcatc
aagatgggcgcccgcatccagggccatggcaccgaccgcatcgtcatcgacggcgtggcc
agcctgcacggcgccgagcacagcgtcatacccgaccgcatcgaggccggcacgttcctt
tgcgccgtcggcgcggccggcggcgacatcacgctgcgcaacgccgcccccgacaccctg
ggcgccacgctcgacaagctgatcgaggccggcctcaccatcgaaaccggccccgactgg
attcgcggcgccatgcagggccggcctcgcgccgtgggcgcccgcacgcacgaatatccg
ggcttcgccaccgacatgcaagcccagctgatggcgctcgacaccgtggcgcagggcacc
gcggtcatcgtcgagaacatcttcgagaaccgctacatgcacgtgcaggaactgcgccgc
atgggcgccgacatcgacatcgacggccataccgccgtggtgcgcggcgtgccgcgcttg
tcgggcgccgcggtcatggccaccgacctgcgcgcctcggccagcctggtcatcgccggc
ctggccgccgaaggccagacccaggtcgaccgcatctatcacctcgaccgcggctacgac
cgaatggaagtcaagctgcgcgccctgggcgccaacatccagcgcctgaccggcaaggaa
cccgcatga

DBGET integrated database retrieval system