KEGG   Bordetella petrii: Bpet0317Help
Entry
Bpet0317          CDS       T00637                                 

Gene name
trpC
Definition
(GenBank) trpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bpt  Bordetella petrii
Pathway
bpt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01130  Biosynthesis of antibiotics
bpt01230  Biosynthesis of amino acids
Module
bpt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bpet0317 (trpC)
Enzymes [BR:bpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Bpet0317 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth
Motif
Other DBs
NCBI-ProteinID: CAP40649
UniProt: A9HY11
Position
complement(350740..351528)
Genome map
AA seq 262 aa AA seqDB search
MNDILAKILAVKAEEVATARQMRSEAELLREAQARQDVRGFAQAIEDKIAQGKAGVIAEI
KKASPSKGVLRENFDPAAIAATYAVHGAACLSVLTDVQFFQGSHDNLRRARAACPLPVLR
KDFVIDPYQVISARAMGADCVLLIVAALAPSQLRELETLAMELGMDVLVEVHDAKELDIA
LSLKTPLLGINNRNLRTFETSLQNTLNLLPQIPAGKRVITESGILSPEDVKLMRSHQVHA
FLVGEAFMRAEDPGVELARLMG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatattcttgcgaagatcctcgccgtgaaggccgaggaagtcgcgactgctcgc
caaatgcgcagcgaagccgagctgctgcgcgaggcgcaggcccggcaggacgtacgcggc
tttgctcaggccatcgaagacaagatcgcccagggcaaggccggcgtcattgccgaaatc
aagaaagcctcgccgtccaagggcgtgctgcgcgagaacttcgaccccgccgccattgcc
gccacctatgcggtgcacggggcggcctgcctgtcggtgctgaccgacgtgcagttcttc
cagggttcgcacgacaacctgcggcgcgcccgcgctgcctgcccgctgcccgtgctgcgc
aaagacttcgtcatcgacccctaccaggtgatctcggcgcgggccatgggagccgactgc
gtgctgcttatcgtggcggccctggcgccgtcgcaactgcgcgaactggaaaccctggcc
atggaactgggcatggatgtgctggtcgaggtgcatgacgctaaggagctggacattgcc
ctgagcctgaaaacgcccttgctgggcatcaacaaccgcaacctgcgcaccttcgagacc
agcctgcagaacacgctgaacctgctgccgcagattcccgccggcaagcgggtcattacc
gaaagcggcattctgtcgcccgaggacgtcaagctcatgcgcagccaccaggttcacgcc
ttcctggtgggcgaagccttcatgcgcgcggaagacccgggcgtggaactggcccggttg
atgggctaa

DBGET integrated database retrieval system