KEGG   Bordetella petrii: Bpet0333Help
Entry
Bpet0333          CDS       T00637                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpt  Bordetella petrii
Pathway
bpt00071  Fatty acid degradation
bpt00280  Valine, leucine and isoleucine degradation
bpt00281  Geraniol degradation
bpt00310  Lysine degradation
bpt00360  Phenylalanine metabolism
bpt00362  Benzoate degradation
bpt00380  Tryptophan metabolism
bpt00410  beta-Alanine metabolism
bpt00627  Aminobenzoate degradation
bpt00640  Propanoate metabolism
bpt00650  Butanoate metabolism
bpt00903  Limonene and pinene degradation
bpt00930  Caprolactam degradation
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01120  Microbial metabolism in diverse environments
bpt01130  Biosynthesis of antibiotics
bpt01212  Fatty acid metabolism
Module
bpt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bpet0333
   00650 Butanoate metabolism
    Bpet0333
  Lipid metabolism
   00071 Fatty acid degradation
    Bpet0333
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bpet0333
   00310 Lysine degradation
    Bpet0333
   00360 Phenylalanine metabolism
    Bpet0333
   00380 Tryptophan metabolism
    Bpet0333
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bpet0333
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bpet0333
   00281 Geraniol degradation
    Bpet0333
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet0333
   00627 Aminobenzoate degradation
    Bpet0333
   00930 Caprolactam degradation
    Bpet0333
Enzymes [BR:bpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bpet0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: CAP40665
UniProt: A9HY30
Position
366016..366792
Genome map
AA seq 258 aa AA seqDB search
MSESFVLVETRGRVGLLTLNRPKALNALNDQLMNELGAALLAFEADDGIGAVVITGSEKA
FAAGADIGAMKDWSYMDVYGSEYITRNWETLKRIRKPVIAAVSGYALGGGCELAMMCDII
IAADTAKFGQPEIKLGVIPGAGGTQRLPRAVGKAKAMDLALTARMMGAEEAERAGLVSRV
VPADKLMDEAIEAATVIASMSLPSVMMAKECVNRAFESSLNEGLLFERRVFHSLFATEDQ
KEGMAAFVEKRPPVFRHK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatcgtttgtgctggtcgaaacccgtggccgcgtcgggttgctgacgctgaat
cgtcccaaggcgctcaatgcgctcaacgaccagctcatgaatgagctgggggccgcgctg
ctggccttcgaggccgacgacggcatcggggcggtggtcatcacgggcagcgaaaaggca
ttcgccgccggcgcagacatcggcgccatgaaagactggtcgtacatggatgtctatggc
agcgagtacatcactcgcaactgggaaaccctcaagcggatccgcaagcccgtcatcgcg
gccgtgtcgggctacgccctgggcggcggctgcgaactcgcgatgatgtgtgacatcatc
atcgccgccgacaccgccaagttcggccaacccgaaatcaagctgggcgtcatccccggc
gctggcggcacgcagcgcctgccgcgcgcggtaggcaaggccaaggccatggacctggcc
ctgaccgcacgcatgatgggcgccgaagaggccgaacgcgccggcctggtgtcgcgcgtg
gtgccggccgacaagttgatggacgaagccatcgaggccgccaccgtcattgcctcgatg
tcgctgccttcggtcatgatggccaaggaatgcgtcaaccgcgctttcgagtcgtcgctc
aacgaagggctgctgttcgaacgccgcgtgttccattcgctgttcgccaccgaagaccag
aaagaaggcatggccgccttcgtggaaaagcggccgccggtcttccgccacaaataa

DBGET integrated database retrieval system