KEGG   Bordetella petrii: Bpet0680Help
Entry
Bpet0680          CDS       T00637                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bpt  Bordetella petrii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bpet0680
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bpet0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
751983..752384
Genome map
AA seq 133 aa AA seqDB search
MKPRVIVGASCLVAAALAGGAARAAAAGYTGDAMRGQSVYERCLACHAIAYDRTGPRHCG
LFGRRAGSVPGFDYSEAMKHSGIVWNEQTLDVFLKSPMTAVPGTSMGYAGIPDPQERADL
IAYLKQAPACAPQ
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcgcgtcatcgtcggcgccagttgcctggtggcggcggcactggccggcggc
gcggcaagggccgccgcggccggctacacgggtgatgccatgcgcggccagtcggtctac
gagcgttgcctggcgtgccacgcgattgcctacgatcgcaccggtcctcggcattgcggc
ctgttcgggcgccgcgccggcagtgtgcctggctttgactattccgaggccatgaagcat
tccggcatcgtgtggaacgagcagacgctggatgtgttcctgaaaagcccgatgacggcg
gtgccgggcacgtccatgggctatgccggtatccccgacccccaggagcgcgccgatctc
atcgcttacctgaagcaggcgcccgcctgtgcgccgcagtag

DBGET integrated database retrieval system