KEGG   Bordetella petrii: Bpet0693Help
Entry
Bpet0693          CDS       T00637                                 

Gene name
murE
Definition
bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase (EC:6.3.2.13)
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
bpt  Bordetella petrii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bpt00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bpt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
769844..772675
Genome map
AA seq 943 aa AA seqDB search
MSTVRPLAAAAADALAWLRARVAAGAHLRLDSRDVAAGDVFVACSGGSADGRAFIGQALA
RGAAAVLCQAPAPGDVATDARVRAVPDLRELLGELADDWYGRPSAALSVVAVTGTNGKTS
CVQWVAQTLTDAGKPCGSIGTLGAMLPDGRTLGGELTTPDVLSMHRILAAMRAAGAQAVA
LEASSIGIEQGRLDGVRIAVAGFTNLTRDHLDYHGSMERYEQAKARLFQWPGLAAAVINA
DDAAGERLLRTLPRGLALGYTQQDVPTAFQARELQATAHGQVFTLATPDGEAQVVTSLLG
RHNVSNLLLVAGVLYKLGWPLAQLARALAATRPVAGRLQVVSPLPLRALGATGRGPLVVV
DYSHTPDSLARALAALRPVADARGGRLVCLFGCGGERDTGKRPEMGRIAADLADKITVSS
DNPRGEDPAAIIAQIVAGIPRGARLQVEADRARAIMQTIWAADPDDVVLLAGKGHETYQD
AGGVKLPFDDREWARLALLLPHAGALSTDTRSIGANEVFLALTGEQFDGHAYLAQAESAG
ACAAIVAHPVDGASLPQLVLGDTRQALQRIGAAWRARYSLPVIGVAGSNGKTTTKEMIAA
ILADWQGEAGRLATAGNFNNDIGVPLTLLRLRAQHRAAVIELGMNHPGEIAVLAALAAPS
VALVTNAQREHQEFMHSVEAVAQENGASIEALPEDGVAVFPGDDPHCGIWEAQAGARRVL
RFGLQPGLDVYAEQIDATPHDTRCRVVTPAGSADLVLPVAGLHNLRNALAAIAAALAAGA
PLAGAVRALSAFSAVAGRMQRQTLDDGTILIDDTYNANPDSVRAAVDVLARLPAPRALVL
GDMGEVGDNGPAMHREVGEYARQHGIDTLYTLGEASRDSAAAFGPGALACASVDEIVAAL
RGARPASLLVKGSRFMRMERVVKVLVTNNNKTTAERQGDPHAA
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggtccgtcctctcgccgccgcggccgccgatgcgctggcctggctgcgcgcg
cgcgtggcggccggcgcacatttgcggctggattcgcgcgacgtggcggcgggcgatgtg
tttgttgcctgctccggcggttcggcagacggccgcgcgttcatcggccaggccctggcg
cgcggcgcggccgcggtgctgtgccaggcgccggcgccgggcgatgtggccaccgacgcg
cgcgtgcgcgccgtgcccgacctgcgcgagttgctgggcgaactggccgacgactggtac
ggccgcccttcggctgccctgagcgtggtcgcggttaccggcaccaatggcaagacttcc
tgcgtccaatgggtggcccagacgctgaccgatgccggcaagccctgcggcagcatcggc
accctgggcgccatgttgccggacggacgcacgctgggcggtgaactgaccacaccggac
gtgctgagcatgcaccgcatcctggctgccatgcgcgccgccggcgcccaggcagtggcg
ctggaggcctcgtctatcggcatcgagcagggccggctggacggcgtgcgcattgccgtg
gccggcttcacgaacctgacgcgcgaccatctcgactaccacggctcgatggagcgctac
gagcaagccaaggcgcgcttgttccaatggcccggcctggccgcggctgtcatcaatgcc
gacgatgcggccggcgagcgcctgctgcgcacgctgccgcgcggcctggcgctgggctac
acccagcaggatgtacccacggccttccaggcgcgcgaactgcaggccacggcgcacggc
caggtgtttacgttggccacgcccgacggcgaagcgcaggtggtgacgtcgctgctgggc
cgtcacaacgtatcgaacctgctgctggttgccggcgtgctgtacaagctgggttggccg
ttggcgcagcttgcccgcgcgctggccgctacccggccggttgccggccgcctgcaggtg
gtctcgccgctgcccttgcgcgcccttggggccacgggccgggggccgctggtcgtggtt
gattattcccatacgcccgactcgctggctagggccttggcggctctgcggccggtggcc
gacgcgcgcggcggccggctggtgtgcctgttcggctgcggtggcgagcgcgacacgggc
aagcgcccggaaatgggccgcattgccgccgatctggccgacaagatcacggtgtccagc
gacaacccgcgcggcgaagatccggccgccatcatcgcgcagatcgttgccggtattccg
cgtggcgcgcgcctgcaggtcgaggccgaccgcgcgcgcgccatcatgcagaccatctgg
gccgccgacccggatgacgtcgtcctgctggcaggcaagggccacgaaacctaccaggac
gcgggtggcgtcaagctgcccttcgatgaccgggaatgggcgcggctggctctgttgctg
ccgcacgccggggcgctgtccaccgatacccgcagcatcggcgccaacgaagtgttcctg
gcgctgactggcgagcagttcgacggccatgcctatctggcgcaggccgagtccgctggc
gcatgcgcggccatcgtggcgcatccggtcgatggcgcgtcgctgccgcagctggtgctg
ggcgacacgcgccaggcgctgcagcgcatcggcgcggcatggcgcgctcgctactcgctg
ccggtgatcggcgtggcgggcagcaacggcaagaccactactaaagaaatgattgcagcc
atcctggccgactggcagggtgaggcgggtcgcctggccacggcgggcaacttcaacaac
gacatcggcgtgcctctgacgctgctgcgcctgcgcgcacagcatcgcgccgcggtgatc
gagctgggcatgaaccatcccggcgaaatcgcggtgctggccgctttggccgcgccctcg
gtcgccctggtcaccaatgcccagcgcgagcaccaggagttcatgcattcggtcgaggcc
gtggcgcaagaaaatggcgccagcatcgaggccctgccggaagacggcgtggcggtgttc
cctggcgacgatccgcactgcggcatctgggaagcccaggccggcgctcgccgcgtgctg
cgcttcgggctgcagccggggttggacgtttatgccgagcagatcgacgccacgccgcac
gatacgcgctgccgtgtggtcacgccggctggtagcgccgacctggtcttgccggtggcg
ggcctgcacaacctgcgcaacgcgctggcggccatcgccgcggccctggccgcgggcgcg
ccgctggccggcgccgtacgggcgctgtcggccttcagcgcggtggccggacgcatgcag
cgccagacgctggacgacggcacgatactgatcgacgacacctacaacgccaacccggat
tcggtgcgcgcggcggtggacgtgctggctcggctgccggcgccacgggccctggtgctg
ggcgacatgggcgaagtgggcgacaacgggccggccatgcatcgtgaggtgggcgagtac
gcccgccagcacggcatcgatacgctgtacacgctgggcgaggccagccgcgacagtgcg
gccgcatttggcccgggcgcgctggcttgcgcgtcggttgatgaaatcgtggcggcgctg
cgtggcgcgcggccagccagcttattggtgaaaggttcgcgctttatgcgcatggagcgg
gtggtgaaggtgctggtgaccaacaataacaagacgacggccgagcgccagggagatccg
catgctgcttga

DBGET integrated database retrieval system