KEGG   Bordetella petrii: Bpet0904Help
Entry
Bpet0904          CDS       T00637                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bpt  Bordetella petrii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bpet0904 (ruvA)
Enzymes [BR:bpt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bpet0904 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1000869..1001441)
Genome map
AA seq 190 aa AA seqDB search
MIGRITGTLIEKLPPTICVDVNGLGYDIEVPMSTLYALPELGARVTLHTHLTVREDAHIL
YGFATAAERGAFRELIKVSGIGARTALSVLSGLSVSDLAQAITLQESGRLTRVPGIGKKT
AERLLLEMRGKLGADIGATAHAVPDSQTDILNALLALGYSDKESQAALKKLPEGTGVSEG
IRLALKALVR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcatcaccggaacgttgatcgagaaactgccgcccaccatctgcgtggac
gtcaatggcctgggctatgacatcgaggtgcccatgagcaccttgtatgccctgcccgag
ctcggcgcgcgggtcaccctgcatacgcacctgacggtgcgcgaagacgcgcacattttg
tacggcttcgccacagcggccgagcgcggcgcgttccgcgagctgatcaaggtcagcggc
atcggcgcgcgcaccgcgctgtcggtactgtcgggcctgtcggtcagcgacctggcgcag
gccatcacgctgcaggagtcgggccgcctgacgcgcgtgcccggcatcggcaagaaaacg
gctgaacgcctgttgctggaaatgcgcggcaaactgggcgccgacatcggcgccacggcg
cacgcggtgcccgacagccagaccgacatcctgaatgccctgctggccctgggatattcc
gacaaggaatcgcaggcggcgctgaagaaactgcccgaaggcaccggggtgtccgagggc
atccggctggcgctgaaagcgctggtgcggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system