KEGG   Bordetella petrii: Bpet0916Help
Entry
Bpet0916          CDS       T00637                                 

Gene name
galU1
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpt  Bordetella petrii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bpet0916 (galU1)
   00052 Galactose metabolism
    Bpet0916 (galU1)
   00500 Starch and sucrose metabolism
    Bpet0916 (galU1)
   00520 Amino sugar and nucleotide sugar metabolism
    Bpet0916 (galU1)
Enzymes [BR:bpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bpet0916 (galU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1011196..1012032)
Genome map
AA seq 278 aa AA seqDB search
MRPIRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRN
KRAIEDHFDSAPELEADLESKGKHELLAMVRGILPAHVNCLYIRQAAPLGLGHAVLTAAP
AVGNEPFAVLLADDLIDADTPVLKQLIDASYAHDASVLGVQDVPREDTRKYGIVAARPID
DRTARITHIVEKPAPEEAPSTLAVVGRYVLEPEIFDHLRATQIGAGNEIQLTDGIAALMG
ARPVLAHRYTGQRYDCGSKAGMFQATVALGRKYHGLVA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccaatccgcaaagccgtttttcctgtcgcaggaatgggcacccggtttctgcct
gccaccaaggccatgcccaaggaaatgctgccggtggtcgacaagccactgatccagtac
gccgtggaagaagccgtggcggccggcatcaccgacctgatcttcgtcacggggcgcaac
aagcgcgccatcgaagaccacttcgactcggcccccgaactcgaggccgacctggaaagc
aagggcaagcacgagctgctggccatggtgcgcggcattctgccggcgcatgtcaattgc
ctgtatatccgccaggccgccccgctggggctgggccatgccgtgctgacggccgccccc
gccgtgggcaacgaacctttcgccgtgttgctggccgacgacctgatcgacgccgacact
ccggtgctgaagcagctcatcgacgcgtcgtacgcccatgacgccagcgtgctgggcgtg
caggatgtgccccgcgaagacacgcgcaaatacggcatcgtggcggcgcgccccattgac
gaccgcaccgcccgcatcacgcacatcgttgaaaagcctgcgcccgaggaagccccctcg
accctggctgtggtgggccgctacgtgctcgagcccgaaatcttcgaccatctgcgggcc
acgcagatcggggcgggcaatgaaatccagctgaccgacggcatcgccgccctgatgggc
gcgcgcccggtgttggcgcaccgctacacggggcaacgctacgactgcggcagcaaggcc
gggatgttccaggccacggtagccctgggccgcaagtaccacgggctggtggcgtag

DBGET integrated database retrieval system