KEGG   Bordetella petrii: Bpet1003Help
Entry
Bpet1003          CDS       T00637                                 

Definition
phage related lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bpt  Bordetella petrii
Brite
Enzymes [BR:bpt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Bpet1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1079149..1079589
Genome map
AA seq 146 aa AA seqDB search
MINELTRLLRGDEGEVLHAYRDHLGYLTIGVGRLIDKRKGGGISTAESALLLSNDIAEKE
AELDRRLPWWRDLPDARRAVLMAMAFQMGVDGLLSFENTLAMVKAGDCDGAARGMLASLW
ARQTPERAHRMSEQMRTNIWHFKEGT
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgaattgacacggctgctgcgcggcgacgagggtgaagtcttgcacgcctac
cgggatcacctgggctacctgaccatcggggtgggccggctcatcgacaagcgcaagggc
ggcggcatcagcacggcggaatcggccctgctgctgagcaatgacatcgccgagaaagag
gccgaactggaccgtcggttgccctggtggcgcgatttgcccgacgcgcggcgcgccgtg
ctgatggccatggcgttccagatgggcgtcgatgggttgctgagcttcgagaacaccctg
gccatggtcaaggctggggactgtgacggtgccgcgcgcggcatgctggccagcctgtgg
gcgcgccagacgcccgaacgtgcgcaccgcatgtccgagcagatgcggacaaacatctgg
cactttaaggaaggcacatga

DBGET integrated database retrieval system