KEGG   Bordetella petrii: Bpet1737Help
Entry
Bpet1737          CDS       T00637                                 

Gene name
trpB
Definition
(GenBank) trpB (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpt  Bordetella petrii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bpet1737 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bpet1737 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bpet1737 (trpB)
Enzymes [BR:bpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bpet1737 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1792919..1794118
Genome map
AA seq 399 aa AA seqDB search
MKPYDLPDAQGHFGQYGGVFVAETLIHALDELRAAYDHCRLDPKFIETFNYELKHFVGRP
SPVYHAARWSRELGGAQIWFKREDLNHTGAHKVNNCIGQALLARHMGKPRVIAETGAGQH
GVATATVAARYGMECVVYMGSEDVRRQASNVYRMKLLGATVVPVESGSRTLKDALNEAMR
DWVTNIENTFYIIGTVAGPDPYPRMVRDFQTVIGNECLEQMPQDAGRQPDYVVASVGGGS
NAMGIFYPYIPHENVRLIGVEAAGEGLDSGRHAASLAAGQVGVLHGNRTYVMQNADGQVQ
ETHSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDDEALAAFHDCCRIEGIMPALESSHAI
AQAVKMAPTLPKDTIILVNLSGRGDKDMHTVAERAGIQF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccttacgacctcccggatgcccagggccattttggccaatatggcggcgtgttc
gtggccgaaacgctgatacacgcgctcgatgagctgcgcgcggcctacgatcattgccgg
ctcgatcccaagttcatcgaaactttcaactacgagctcaagcacttcgtggggcggccc
agccctgtctatcacgcggcccgctggtcgcgcgaactgggcggcgcgcagatctggttc
aagcgcgaagacctcaaccacaccggcgcgcacaaggtcaacaactgcatcggccaggcc
ctgctggcccgccacatgggcaagccgcgcgtcatcgccgaaaccggcgccggccagcac
ggcgtggccaccgccactgtggcggcccgctatggcatggaatgcgtggtctacatgggc
agcgaagacgtccggcgccaggcctccaacgtgtaccgcatgaagttgctgggcgccacg
gtggtgcccgtcgagtccggttcgcgcaccctgaaagacgccctgaacgaggccatgcgc
gactgggtcaccaacatcgagaacaccttctacatcatcggcacggtggcaggccccgat
ccctacccgcgcatggtgcgcgacttccagaccgtcatcggcaacgaatgcctggaacaa
atgccccaagacgccggccgccagcccgactacgtggtggcttcggtgggcggcggctcg
aacgccatgggtatcttctacccctacattccccatgaaaatgtccggctcatcggcgtc
gaagccgccggcgaggggctggacagcggacgtcacgccgcgtcgctggccgctggccag
gtgggcgtgctgcacggcaaccgtacctacgtcatgcagaacgccgatggccaggtgcag
gaaacccattccgtgtcggccgggctcgactaccccggcgtgggccccgagcacgcctgg
ctgaaagacagcgggcgcgcccagtacgtgggcattaccgacgacgaagcgctggccgcg
ttccacgactgctgccgcatcgagggcatcatgccggcgctcgagtcttcgcatgccatc
gcgcaggccgtcaaaatggcgcccacgctgccgaaagacaccatcatcctggtcaatttg
tcgggccgtggcgacaaagacatgcacaccgtcgccgaacgcgcgggcatccagttctga

DBGET integrated database retrieval system