KEGG   Bordetella petrii: Bpet1738Help
Entry
Bpet1738          CDS       T00637                                 

Gene name
trpA
Definition
(GenBank) trpA (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpt  Bordetella petrii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bpet1738 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bpet1738 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bpet1738 (trpA)
Enzymes [BR:bpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bpet1738 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1794123..1794983
Genome map
AA seq 286 aa AA seqDB search
MTTRTDRIAAAFSRVAETGRASALIPYIAAGDPSPDATVPLMHALVNAGADVIELGVPFS
DPMADGPVIQRAAERAIAQGTGLRRVLELVAQFRRDDSTTPVVLMGYANPIECMGQQAFA
QAAQQAGVDGVLVVDYPPEEIDAFAGQLDACGIAPIFLLAPTSTEARIQAVARIARGYVY
YVSLKGVTGAGSLNTDDVAARLALIRRHVSVPVGVGFGIRDAASAQHIARVADAVVIGSK
LIETIEQAVATAPAGKQTEAAVAAATQWLGGIRQALDQIKRGNPPA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccgaaccgatcgcatcgccgcggcgttctcccgtgtggccgaaaccggccgc
gcgtccgcgctcattccctacatcgccgcgggcgacccgtcgccggacgccaccgtgccg
ctcatgcacgcgctggtgaacgccggcgccgacgtcatcgaactgggcgtgccgttctcc
gaccccatggccgacggcccggtcatccagcgcgccgccgagcgcgccatcgcgcagggc
acgggcttgcgccgcgtgctcgagttggtcgcccagttccgccgcgacgactccaccacg
ccggtggtgctgatgggctacgccaaccccatcgaatgcatgggccagcaggcctttgcc
caggcggcccagcaggccggcgtcgacggggtgctggtggtcgactacccgcccgaagaa
atcgacgcctttgccgggcagctcgacgcctgcggcatcgcacccatcttcctgctggcg
cccacgtctaccgaggcgcgcatccaggccgtggcccgcatcgcgcgcggctacgtctac
tatgtgtcgctcaagggtgtcacgggcgcgggcagcctgaacaccgacgacgtggcagcc
cgcctggcgctgatccggcgccacgtcagcgttccggtgggggtgggcttcggcatccgc
gacgcggccagcgcccagcatatcgcgcgcgtcgccgacgccgtggtcattggcagcaaa
ctcatcgaaaccatcgagcaggcggttgccaccgcgcctgccggcaagcagaccgaggcc
gccgtggccgccgccacgcagtggctgggcggcatccggcaggcgctcgaccaaatcaaa
cgaggcaatccgccggcctga

DBGET integrated database retrieval system