KEGG   Bordetella petrii: Bpet1775Help
Entry
Bpet1775          CDS       T00637                                 

Gene name
mmsA1
Definition
methylmalonate-semialdehyde dehydrogenase (EC:1.2.1.27)
Orthology
K00140  
malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
bpt  Bordetella petrii
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Inositol phosphate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpet1775 (mmsA1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bpet1775 (mmsA1)
   00562 Inositol phosphate metabolism
    Bpet1775 (mmsA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bpet1775 (mmsA1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bpet1775 (mmsA1)
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     Bpet1775 (mmsA1)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     Bpet1775 (mmsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1830739..1832232
Genome map
AA seq 497 aa AA seqDB search
MSEVPSVPLLIGGKLVQSKTTEWRDVIDPATQQVVARVPFATREELDLAVANAKEAFQTW
RNTGQGARMRVMLKLQQLLRENTAKLAEMITREHGKTLPDAEGEVGRGLEVVEHACSIAN
LQLGEYAENAAGGIDVYTLIQPLGVCAGITAFNFPVMLPCFMFPIAVACGNTFVLKPSEQ
DPTSSLFLAQLALEAGLPPGVLNVVHGGPEIANGLCEHPDIKAVSFIGSTRVGSEIYQRA
SNAGKRCQAMMGAKNHCVILPDADPEVALNQLLGAAFGAAGQRCMAASVAVLVGEARNWL
PDFVERAKGLKVNAGTDRKADLGPLVSPNAKKRVESLIQKGVDEGARLLLDGRNLKVPGF
EQGNFVGPTVFDGVTENMTIYTEEIFGPVLSVVGVDTLEEAVAFINRNPNGNGVALFTQD
GGAARYFQNNIDVGQVGINIPIPVPVAWFSFTGSRGSKLGDLGPNGKQAVQFWTQTKTVT
ARWSAHGRTVNTTISMR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagttcccagcgtgccgctactgatcggcggcaagctcgtgcaatccaagacg
accgaatggcgcgacgtgatcgatccggccacgcagcaggtggtcgcccgcgtgcccttc
gccacgcgcgaggagctggacctggcggtggccaatgccaaagaagccttccagacctgg
cgcaataccgggcagggcgcgcgcatgcgcgtcatgctgaagctgcagcaattgctgcgc
gaaaacaccgccaagctggccgagatgatcacccgcgagcatggcaagaccctgccggac
gccgagggcgaagtagggcgcggcctcgaagtggtggagcatgcgtgctctattgccaac
ctgcaattgggcgaatacgccgagaacgccgccggcggcatcgacgtctacaccctgatc
cagcccctgggcgtgtgcgccggcattacggcgttcaacttcccggtgatgctgccgtgc
ttcatgtttcccattgccgtggcttgcggcaacaccttcgtgctcaagccgtccgagcag
gacccgacgtcttcgctgttcctggcgcagctcgcgctcgaggccggcctgccgccgggc
gtgctgaacgtcgtgcatggcggccccgagatcgccaacgggctgtgcgagcatcccgat
atcaaggccgtgtcgttcatcggttcgacccgcgtcggttccgagatctaccagcgcgcc
tctaatgccggcaagcgttgccaggccatgatgggcgccaagaaccactgcgtgatcctg
cccgatgccgaccctgaagtcgcgttgaaccaactgctgggcgccgctttcggcgcggcc
ggccagcgctgcatggcggcctcggtagcggtgctggtgggcgaggcccgcaattggctg
cccgacttcgtcgagcgggccaagggcctgaaggtcaatgccggcaccgaccgcaaggcc
gatctggggccgctggtgtcgcccaacgccaagaagcgggtggaaagcctgatccagaaa
ggcgtggacgaaggcgccaggctgctgctcgacggccgcaacctgaaggtgccaggcttc
gagcagggcaacttcgtgggccccacggtgttcgacggcgtgaccgagaacatgaccatc
tacaccgaagaaatcttcggccccgtgctcagcgtggtgggcgtcgataccctggaagaa
gcggtggccttcatcaatcgcaaccccaacggcaacggtgtggcgctgttcactcaggat
ggcggcgcggcgcgctacttccaaaacaacatcgacgtggggcaggtgggtatcaatatt
cccattcccgtgccggtggcctggttcagcttcaccggttcgcgcggctcgaagctgggc
gacctggggcccaacggcaagcaggccgtgcagttctggacccaaaccaagaccgtgacc
gcgcgctggtcggctcacgggcgcacggtgaacacgaccatctcgatgcgttga

DBGET integrated database retrieval system