KEGG   Bordetella petrii: Bpet1775Help
Entry
Bpet1775          CDS       T00637                                 

Gene name
mmsA1
Definition
methylmalonate-semialdehyde dehydrogenase (EC:1.2.1.27)
Orthology
K00140  
malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
bpt  Bordetella petrii
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Inositol phosphate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bpt01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bpt00640]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bpt00562]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:bpt00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bpt00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1830739..1832232
Genome map
AA seq 497 aa AA seqDB search
MSEVPSVPLLIGGKLVQSKTTEWRDVIDPATQQVVARVPFATREELDLAVANAKEAFQTW
RNTGQGARMRVMLKLQQLLRENTAKLAEMITREHGKTLPDAEGEVGRGLEVVEHACSIAN
LQLGEYAENAAGGIDVYTLIQPLGVCAGITAFNFPVMLPCFMFPIAVACGNTFVLKPSEQ
DPTSSLFLAQLALEAGLPPGVLNVVHGGPEIANGLCEHPDIKAVSFIGSTRVGSEIYQRA
SNAGKRCQAMMGAKNHCVILPDADPEVALNQLLGAAFGAAGQRCMAASVAVLVGEARNWL
PDFVERAKGLKVNAGTDRKADLGPLVSPNAKKRVESLIQKGVDEGARLLLDGRNLKVPGF
EQGNFVGPTVFDGVTENMTIYTEEIFGPVLSVVGVDTLEEAVAFINRNPNGNGVALFTQD
GGAARYFQNNIDVGQVGINIPIPVPVAWFSFTGSRGSKLGDLGPNGKQAVQFWTQTKTVT
ARWSAHGRTVNTTISMR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagttcccagcgtgccgctactgatcggcggcaagctcgtgcaatccaagacg
accgaatggcgcgacgtgatcgatccggccacgcagcaggtggtcgcccgcgtgcccttc
gccacgcgcgaggagctggacctggcggtggccaatgccaaagaagccttccagacctgg
cgcaataccgggcagggcgcgcgcatgcgcgtcatgctgaagctgcagcaattgctgcgc
gaaaacaccgccaagctggccgagatgatcacccgcgagcatggcaagaccctgccggac
gccgagggcgaagtagggcgcggcctcgaagtggtggagcatgcgtgctctattgccaac
ctgcaattgggcgaatacgccgagaacgccgccggcggcatcgacgtctacaccctgatc
cagcccctgggcgtgtgcgccggcattacggcgttcaacttcccggtgatgctgccgtgc
ttcatgtttcccattgccgtggcttgcggcaacaccttcgtgctcaagccgtccgagcag
gacccgacgtcttcgctgttcctggcgcagctcgcgctcgaggccggcctgccgccgggc
gtgctgaacgtcgtgcatggcggccccgagatcgccaacgggctgtgcgagcatcccgat
atcaaggccgtgtcgttcatcggttcgacccgcgtcggttccgagatctaccagcgcgcc
tctaatgccggcaagcgttgccaggccatgatgggcgccaagaaccactgcgtgatcctg
cccgatgccgaccctgaagtcgcgttgaaccaactgctgggcgccgctttcggcgcggcc
ggccagcgctgcatggcggcctcggtagcggtgctggtgggcgaggcccgcaattggctg
cccgacttcgtcgagcgggccaagggcctgaaggtcaatgccggcaccgaccgcaaggcc
gatctggggccgctggtgtcgcccaacgccaagaagcgggtggaaagcctgatccagaaa
ggcgtggacgaaggcgccaggctgctgctcgacggccgcaacctgaaggtgccaggcttc
gagcagggcaacttcgtgggccccacggtgttcgacggcgtgaccgagaacatgaccatc
tacaccgaagaaatcttcggccccgtgctcagcgtggtgggcgtcgataccctggaagaa
gcggtggccttcatcaatcgcaaccccaacggcaacggtgtggcgctgttcactcaggat
ggcggcgcggcgcgctacttccaaaacaacatcgacgtggggcaggtgggtatcaatatt
cccattcccgtgccggtggcctggttcagcttcaccggttcgcgcggctcgaagctgggc
gacctggggcccaacggcaagcaggccgtgcagttctggacccaaaccaagaccgtgacc
gcgcgctggtcggctcacgggcgcacggtgaacacgaccatctcgatgcgttga

DBGET integrated database retrieval system