KEGG   Bordetella petrii: Bpet1807Help
Entry
Bpet1807          CDS       T00637                                 

Definition
AMP-binding protein (EC:6.2.1.-)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpt  Bordetella petrii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpet1807
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpet1807
   00620 Pyruvate metabolism
    Bpet1807
   00640 Propanoate metabolism
    Bpet1807
  Energy metabolism
   00680 Methane metabolism
    Bpet1807
Enzymes [BR:bpt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bpet1807
Lipid biosynthesis proteins [BR:bpt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bpet1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1867224..1868888)
Genome map
AA seq 554 aa AA seqDB search
MNDQYHALYQSFRWLVPTQFNIAEACCHRWAASSSDARRIAIYYEDEAGNREVWTYARLA
EAANQLANGLVKMGVERGDRVGVVLGQRPETAVAHMAIYSVGAVVVPLSSLFGPEALETR
LRDSDARIAIVDYASSANLLAISDNCPNLHQIIGIGFADERVLPWRSLLARQPGEFKPVP
TRASDPAILLYTSGTTGAPKGALLPHSVLIGNLPGFVASQDWFPKPNDVFWSPADWAWTG
GMMDALLPTLYFGHPIVGTRGRFTPERAFELMERYQVTNTFLFPTALKMMMKAVPEPASR
YRLALRAVMSAGESVGETVFSWCQTALGITPNEMFGQTEMNYLVGNSRLRWPARPGSMGR
PYPGHQVAVIDDAGQPVAPGETGEIALNRYDIHGFPDPILFLGYWRNEAATQAKFTGDWC
RTGDLASIDADGYLWYAGRADDVFKSAGYRIGPGEIENCLLGHDAVANAAVVPKPDAERG
ALVKAYVVLTPEYAGHDQAQLIQALQEHVRDRLAPYEYPKEIEFIDELPMTTTGKIQRRV
LRQREEARAAATQA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccaatatcacgcgctctaccaatcattccgctggctggtgccgacccaattc
aatattgcggaagcctgctgccaccgctgggcggccagcagctccgacgcccggcgcatc
gccatctattacgaagacgaggccggcaaccgcgaagtctggacctacgcgcgcctggcc
gaggcagccaaccaactggctaatggcctggtcaagatgggcgtcgagcgcggcgaccgt
gtcggtgtggttttaggacaacgccccgagacggccgtggcgcacatggccatctatagc
gtcggcgcagtggtcgtgcccctgtcgtcgctgttcggcccggaagccctggaaacccgg
ctgcgcgactccgacgcccggatcgccatcgtcgactacgcctccagcgccaacctgctg
gccatcagcgacaactgccccaacctgcaccagatcatcggcatcggcttcgccgacgag
cgcgtgctgccgtggcgcagcctgctggcccgccagcccggcgaattcaagcccgtgccc
acgcgcgcgtccgacccggccatcctgctgtacacgtcgggcaccaccggcgcccccaag
ggcgccctgctgccccacagcgtcctgatcggcaacctgccgggcttcgtggcctcgcaa
gattggttccccaagcccaacgacgtattctggtcgccggccgactgggcctggaccggc
ggcatgatggacgccttgctgcccaccctgtatttcggccaccccatcgtgggcacgcgc
gggcgcttcacgcccgagcgggccttcgaactgatggagcgctaccaggtcaccaatacc
ttcctgttccctaccgcgctcaagatgatgatgaaggcggtgcccgagcccgccagccgc
taccggctggccctgcgggcggtcatgagcgcgggcgagagcgtgggcgaaaccgtgttt
tcctggtgccagaccgcgctgggcatcacccccaacgaaatgttcggccagaccgaaatg
aactacctggtgggcaacagccgcctgcgctggccggcccggccgggcagcatgggacgc
ccctacccgggccaccaggtggctgtcatcgatgacgcgggccagccggtcgcgccgggc
gaaaccggcgaaattgctctgaaccggtacgatatccacggttttcccgaccccattctg
ttcctgggctactggcgcaatgaggccgccacccaggccaaattcaccggcgactggtgc
cgcaccggcgacttggccagcatcgatgccgacggctacctatggtatgcgggccgcgcc
gatgacgtgttcaagtcggccggctaccgcatcggcccgggcgaaatcgaaaattgcctg
ctggggcacgacgccgtggccaatgccgcggtagtgcccaagcccgatgccgagcggggc
gcgctggtcaaggcctacgtggtgctgacccccgaatacgccggccacgaccaggcccag
ctcatccaggccttgcaagagcacgtgcgcgaccgcctggcgccctacgagtatccgaag
gaaatcgagttcatcgatgagctgcccatgaccaccaccggtaaaatccagcgcagggtg
ctgcgccagcgcgaagaagcgcgggcggccgccacccaggcctga

DBGET integrated database retrieval system