KEGG   Bordetella petrii: Bpet1807Help
Entry
Bpet1807          CDS       T00637                                 

Definition
(GenBank) putative AMP-binding protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpt  Bordetella petrii
Pathway
bpt00010  Glycolysis / Gluconeogenesis
bpt00620  Pyruvate metabolism
bpt00640  Propanoate metabolism
bpt00680  Methane metabolism
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01120  Microbial metabolism in diverse environments
bpt01130  Biosynthesis of antibiotics
bpt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpet1807
   00620 Pyruvate metabolism
    Bpet1807
   00640 Propanoate metabolism
    Bpet1807
  Energy metabolism
   00680 Methane metabolism
    Bpet1807
Enzymes [BR:bpt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bpet1807
Lipid biosynthesis proteins [BR:bpt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bpet1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAP42146
UniProt: A9IIQ5
Position
complement(1867224..1868888)
Genome map
AA seq 554 aa AA seqDB search
MNDQYHALYQSFRWLVPTQFNIAEACCHRWAASSSDARRIAIYYEDEAGNREVWTYARLA
EAANQLANGLVKMGVERGDRVGVVLGQRPETAVAHMAIYSVGAVVVPLSSLFGPEALETR
LRDSDARIAIVDYASSANLLAISDNCPNLHQIIGIGFADERVLPWRSLLARQPGEFKPVP
TRASDPAILLYTSGTTGAPKGALLPHSVLIGNLPGFVASQDWFPKPNDVFWSPADWAWTG
GMMDALLPTLYFGHPIVGTRGRFTPERAFELMERYQVTNTFLFPTALKMMMKAVPEPASR
YRLALRAVMSAGESVGETVFSWCQTALGITPNEMFGQTEMNYLVGNSRLRWPARPGSMGR
PYPGHQVAVIDDAGQPVAPGETGEIALNRYDIHGFPDPILFLGYWRNEAATQAKFTGDWC
RTGDLASIDADGYLWYAGRADDVFKSAGYRIGPGEIENCLLGHDAVANAAVVPKPDAERG
ALVKAYVVLTPEYAGHDQAQLIQALQEHVRDRLAPYEYPKEIEFIDELPMTTTGKIQRRV
LRQREEARAAATQA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccaatatcacgcgctctaccaatcattccgctggctggtgccgacccaattc
aatattgcggaagcctgctgccaccgctgggcggccagcagctccgacgcccggcgcatc
gccatctattacgaagacgaggccggcaaccgcgaagtctggacctacgcgcgcctggcc
gaggcagccaaccaactggctaatggcctggtcaagatgggcgtcgagcgcggcgaccgt
gtcggtgtggttttaggacaacgccccgagacggccgtggcgcacatggccatctatagc
gtcggcgcagtggtcgtgcccctgtcgtcgctgttcggcccggaagccctggaaacccgg
ctgcgcgactccgacgcccggatcgccatcgtcgactacgcctccagcgccaacctgctg
gccatcagcgacaactgccccaacctgcaccagatcatcggcatcggcttcgccgacgag
cgcgtgctgccgtggcgcagcctgctggcccgccagcccggcgaattcaagcccgtgccc
acgcgcgcgtccgacccggccatcctgctgtacacgtcgggcaccaccggcgcccccaag
ggcgccctgctgccccacagcgtcctgatcggcaacctgccgggcttcgtggcctcgcaa
gattggttccccaagcccaacgacgtattctggtcgccggccgactgggcctggaccggc
ggcatgatggacgccttgctgcccaccctgtatttcggccaccccatcgtgggcacgcgc
gggcgcttcacgcccgagcgggccttcgaactgatggagcgctaccaggtcaccaatacc
ttcctgttccctaccgcgctcaagatgatgatgaaggcggtgcccgagcccgccagccgc
taccggctggccctgcgggcggtcatgagcgcgggcgagagcgtgggcgaaaccgtgttt
tcctggtgccagaccgcgctgggcatcacccccaacgaaatgttcggccagaccgaaatg
aactacctggtgggcaacagccgcctgcgctggccggcccggccgggcagcatgggacgc
ccctacccgggccaccaggtggctgtcatcgatgacgcgggccagccggtcgcgccgggc
gaaaccggcgaaattgctctgaaccggtacgatatccacggttttcccgaccccattctg
ttcctgggctactggcgcaatgaggccgccacccaggccaaattcaccggcgactggtgc
cgcaccggcgacttggccagcatcgatgccgacggctacctatggtatgcgggccgcgcc
gatgacgtgttcaagtcggccggctaccgcatcggcccgggcgaaatcgaaaattgcctg
ctggggcacgacgccgtggccaatgccgcggtagtgcccaagcccgatgccgagcggggc
gcgctggtcaaggcctacgtggtgctgacccccgaatacgccggccacgaccaggcccag
ctcatccaggccttgcaagagcacgtgcgcgaccgcctggcgccctacgagtatccgaag
gaaatcgagttcatcgatgagctgcccatgaccaccaccggtaaaatccagcgcagggtg
ctgcgccagcgcgaagaagcgcgggcggccgccacccaggcctga

DBGET integrated database retrieval system