KEGG   Bordetella petrii: Bpet1821Help
Entry
Bpet1821          CDS       T00637                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bpt  Bordetella petrii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpet1821 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bpet1821 (sdhD)
   00650 Butanoate metabolism
    Bpet1821 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Bpet1821 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1885217..1885600
Genome map
AA seq 127 aa AA seqDB search
MAATKNYGPTRLVVGAHYGVVDFIAQRLTAVIMAVYTLVLIIGVLVMPSFSYENWKALFT
FHVYALPLGQILATLFFFALAWHAWIGVRDIWMDYVRPAGVRMLLQVLTILWLVGSIVYF
AQILWSI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggccgctaccaagaactatggccccacgcgcctggtcgtgggcgcgcattacggcgtc
gtcgatttcatcgcgcagcgcctcaccgccgtcatcatggcggtgtacaccctggtgctt
atcatcggcgtgctggtcatgccgtcgttctcgtatgaaaactggaaggcgctgttcacc
ttccatgtctatgcgcttcccctgggccagatcctggccacactgttcttctttgcgctg
gcgtggcacgcctggatcggcgtgcgcgacatctggatggattacgtcaggcccgcaggc
gtgcgcatgctgctgcaggtgctgaccatcctctggctggtcgggtcgatcgtctatttc
gcgcaaatcctctggagtatctaa

DBGET integrated database retrieval system