KEGG   Bordetella petrii: Bpet1833Help
Entry
Bpet1833          CDS       T00637                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpt  Bordetella petrii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpet1833 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bpet1833 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    Bpet1833 (odhB)
Enzymes [BR:bpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bpet1833 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1903311..1904525
Genome map
AA seq 404 aa AA seqDB search
MAITDVVVPQLSESVSEATLLTWKKQQGAAVEADEILIEIETDKVVLEVPAPASGVLSEI
VEGDGSTVTSGQLLAKIDTAAKAAAAPAPAAEAKAEPAAEKAAAAPAPASNAAAGVASPA
ASKILSEKGVDPATVAGSGRDGRITKADAQGASAAPKAAAAPAAPASLSLDGRPEQRVPM
SRLRARIAERLLQSQQENAILTTFNEVNMQAVIDLRNKYKEKFEKEHGIKLGFMSFFVKA
AVAALKKFPLINASIDGKDIIYHGYFDIGIAVGSPRGLVVPILRNADQLSIAEIEKTIAD
FGKRAADGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAILGVHATKERAVVEKGQ
IVIRPMNYLALSYDHRIIDGREAVLGLVAMKDALEDPQRLLLDL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctattactgacgtcgttgttccccaattgtccgaatccgtgtcggaggcgaccctg
ctcacctggaagaagcagcagggcgcagcggtcgaggccgatgaaatcctgatcgaaatc
gaaaccgacaaggtcgtgctggaagtgcccgcgcccgcttcgggcgtgctgtccgagatc
gtcgaaggcgacggcagcacggtgacttcggggcaactgctcgccaagatcgacacggcc
gccaaggcggccgccgcccccgcgccggccgccgaggccaaggctgagccggccgccgag
aaggctgccgccgcgccggcgcccgcatcgaacgccgctgcgggcgtggcttcgcccgcc
gcctcgaagatcctgtccgaaaagggtgtagatcccgccacggtggcgggcagcggccgt
gacggccgtatcaccaaggccgacgcccagggtgccagcgcggctcccaaggctgccgcc
gcgccggctgcgcctgcctcgctgtcgctcgacggccgccccgaacagcgcgtgcccatg
agccgcctgcgcgcccgcatcgccgagcgcctgctgcagtcgcaacaggaaaacgccatc
ctgaccacgttcaacgaggtcaacatgcaggccgtcatcgacctgcgcaacaagtacaaa
gagaagttcgagaaagagcacggcatcaagctgggcttcatgtcgttcttcgtgaaggcc
gcggttgccgcgctgaagaagttcccgctgatcaacgcttcgatcgacggcaaggacatc
atctaccacggctacttcgacatcggcatcgcggtgggcagcccgcgcggcctggtggtg
ccgatcctgcgcaacgccgaccagctgtcgatcgccgagatcgagaaaaccattgccgac
ttcggcaagcgcgcggccgatggcaagctgggcatcgaagaaatgacgggcggcacgttc
tctatttcgaacggcggcgtgttcggctcgatgctgtccacgcccatcatcaacccgccg
caatcggccatcctgggcgtgcacgccaccaaggaacgcgcggtggtcgaaaagggccag
atcgtcatccggcccatgaactacctggcgttgtcgtacgaccaccgcatcatcgacggc
cgcgaggcggtgctggggctggtggccatgaaggacgcgctggaagatccgcagcgtctg
ttgctggacctgtaa

DBGET integrated database retrieval system