KEGG   Bordetella petrii: Bpet2335Help
Entry
Bpet2335          CDS       T00637                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bpt  Bordetella petrii
Pathway
bpt00220  Arginine biosynthesis
bpt00330  Arginine and proline metabolism
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01130  Biosynthesis of antibiotics
bpt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Bpet2335
   00330 Arginine and proline metabolism
    Bpet2335
Enzymes [BR:bpt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Bpet2335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CAP42678
UniProt: A9IM85
Position
complement(2434615..2435568)
Genome map
AA seq 317 aa AA seqDB search
MPATAATAAPRGLTLIGAPTDIGAGSRGASMGPEALRVAGLGPALQALGHDVEDAGNLTG
PPNPGLPPQNGYRHLAEVAAWNLAVHDAAHAELERGRLPILLGGDHCLGIGSISAVARHC
RFAGKPLRVLWLDAHADFNTQALTPSGNLHGMPVACLCGNGPGPLVGLAGHVPALQPNWI
RQIGIRSVDEGEKSLIDAAGVEVYDMRIIDEIGMRAAMEAALADLAPDTHLHVSFDVDFL
DPEIAPAVATSIPGGPTYREAQLCMEMIADTGRLGSLDIVELNPALDVRNKTAVLATELV
QSLFGKSTLIRRPARGA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgccaccgccgccaccgccgcgccgcgcggcctgaccctgatcggcgcccccacc
gacatcggcgcgggctcgcgcggcgcctcgatggggcccgaagcgctacgcgtggccggc
ctggggcccgccctgcaggccctgggccatgacgtcgaagacgccggcaacctgaccggc
ccgcccaatcccggcctgccgccccagaatggctaccgccatctggccgaagtcgcggcc
tggaacctggcggtgcacgatgcggcgcatgccgaactcgaacgcggccgcctgcccatc
ttgctggggggcgaccactgcctgggcatcggctcgatcagcgccgtggctcgccactgc
cggtttgccggcaagccactgcgcgtgctgtggctggacgcgcacgccgatttcaacacc
caggcgctcaccccttcgggcaacctgcacggcatgcccgtggcctgcctgtgcggcaac
ggccccgggccgctcgtcgggttggccggccatgtgccggcgctgcagcccaactggata
cgccagatcggcatccgcagcgtcgacgaaggagaaaaatcccttatcgacgcggctggc
gtcgaggtctacgacatgcgcatcatcgacgaaatcggcatgcgcgccgccatggaagcc
gcgctggcagacctcgcccccgacacgcatttgcatgtcagcttcgacgtcgacttcctc
gatcccgaaatcgcgcccgctgtcgccaccagcattccaggcggccccacctaccgcgag
gcgcaactctgcatggaaatgatcgccgatactggccggctgggctcgctggacattgtc
gaactgaacccggcgctcgacgtgcgcaacaagacggcggtactggccaccgagctggtg
caaagcctgttcggcaaatcgacgctcatccggcgtccggcacgcggcgcctga

DBGET integrated database retrieval system