KEGG   Bordetella petrii: Bpet2366Help
Entry
Bpet2366          CDS       T00637                                 

Gene name
malQ
Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bpt  Bordetella petrii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bpet2366 (malQ)
Enzymes [BR:bpt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Bpet2366 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2469915..2472014)
Genome map
AA seq 699 aa AA seqDB search
MSASASVADSLTALAEAAGVAPRWIDAHGRRRDTPAETLRAVLAAMDLPADTPAQARDSL
ARLALPASQPPALTIVRTGHSVQLPGVRAGRYLVHYEDGTCDEGQATGAGDDACLQAPDR
PGYHLLELAGRQYALAVAPGRCPSPAQLLQDDSPRAWGIAAQIHSLRRADPSAPAAGGYG
DFGALADLAEQAGRLGADALAVSPMHAMFSARPAACSPYSPSSRLFLNVLYADPGAVFGA
DEVRSAMAAVDAAGRAAALEQACLVDWQAAGARRLALLRKLYDRFERAAPALRDACARFR
EAGGDTLQNHAVFEVLHERHATDWRQWPDALRDPRSSRARGFGAAHEQEVGFHIFMQWLA
RASLGSVQARARQAGMRLGLIADLAVGTDPRGSHAWSRQAEIIEGLSIGAPPDLFNPAGQ
QWGLAAFSPHALQERGYSAFIEMLRAVLADTGGLRIDHILGLARLWVVPAGASPEAGAYL
RYPLNPLLDLVALEAWRHRALIVGENLGTVPEGFNERLAERGILGTSVLWFQTAAPPVRP
PSGTSAAFLAPGEWPADAIAMPTTHDLPTLRGWWEGRDLQWRARLGAAPAVNTQALAERQ
AQRSSLWSGLRAAGLVQGDTPPQTAPIAAMLGFVAATPAPLMLAPLEDLAAVADQPNLPG
TTTEHPNWRQRLPRTSGNLLQDPALRARIEAITAARRSA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccagcgcctctgtcgcggattcactgacggcgttggccgaagccgccggcgtg
gcgccgcgctggatcgatgcgcatggccggcggcgcgacacgcccgccgaaacgctgcgc
gcggtcctggcggccatggatctgcccgccgacacgccggcgcaggcgcgcgacagcctt
gctcgcctggccttgcccgccagccagccgcccgcactgaccattgtccggacgggacac
agcgtgcagctgcccggcgtgcgcgcgggccgctatctcgtccactacgaagacggcact
tgcgacgaaggccaggccaccggggccggcgacgatgcctgcctgcaggctcctgaccgc
cccggctaccacctgctggaactggctgggcgccagtacgcgctggccgttgcgcccggg
cgatgcccatcgccagcgcagctgctgcaggacgattcgccgcgagcctggggcatcgcc
gcgcagatacacagcctgcgccgcgccgacccctcggccccggccgcgggcggctatggc
gacttcggcgcgctggccgacctggccgaacaggcaggccggctcggcgccgacgcgctg
gcggtcagcccgatgcacgccatgttcagcgcccggcccgcagcctgcagcccctactct
ccatcgagccggctcttcttgaatgtgctgtatgccgatccgggcgcagtattcggcgct
gatgaagtgcgctcggccatggcggcagtggatgccgccggacgcgccgcggcgctcgag
caggcctgcctggtcgactggcaggccgccggcgcgcggcgcctggcgctgctgcgcaaa
ctgtacgacaggttcgagcgcgccgcgccggccttgcgcgacgcctgcgcccgctttcgc
gaagccggcggcgacaccctgcagaaccacgccgttttcgaagtgctgcacgaacgccac
gccaccgactggcggcagtggccggacgccttgcgcgaccctcgctcgtcccgcgcccgg
ggctttggcgcggcgcacgaacaggaagtgggctttcacattttcatgcaatggctggcg
cgcgccagtctgggcagcgtccaggcccgcgcgcgccaggccggcatgcgcctggggctg
attgccgacctggcggtgggcacggacccgcgcggcagccatgcgtggagccgccaggcc
gagatcatcgaaggcttgtccataggcgccccgcccgatcttttcaacccagcagggcag
caatggggcctggccgcattctctccccacgcgctgcaggagcgcggatattcggccttc
atcgagatgctgcgagccgtgctcgccgacacgggcggcctgcgcatcgaccacatcctg
gggctggcacgcctgtgggtggtgccggccggcgcctcgcccgaggcgggcgcgtatctg
cgctatccgctgaacccattgctggacctggtggccctggaggcttggcgccaccgggcc
ctgatcgtgggcgagaacctgggcaccgtgcccgaaggcttcaacgagcgcctggccgag
cgcggcattctgggcaccagcgtgctgtggttccagaccgcggcgccgcccgtgcgcccg
ccttccggcacgtccgcggccttcctggcgcccggcgaatggccggccgacgccattgcc
atgcccaccacgcacgacctgcccacgctacgtggctggtgggaaggccgcgacctgcaa
tggcgggctcgtctgggcgccgccccggcggtcaatacccaagccctggccgaacgccag
gcccagcgctcgtccctgtggtccggcctgcgcgccgccggcctggtgcaaggcgacacg
ccaccccaaacggcgcccatcgccgccatgctcggtttcgtagccgccacgccggcgccg
ttgatgctggcgccgctggaagatctggccgccgtggccgaccaacctaacctgcctgga
actaccaccgaacaccccaactggcgccagcgcctgccgcgaacctccggcaacctgctg
caggaccctgcgctgcgcgctcggatcgaggcgatcactgccgcccggagatcggcatga

DBGET integrated database retrieval system