KEGG   Bordetella petrii: Bpet2485Help
Entry
Bpet2485          CDS       T00637                                 

Gene name
gpo
Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bpt  Bordetella petrii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bpet2485 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bpet2485 (gpo)
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bpet2485 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2606257..2606748
Genome map
AA seq 163 aa AA seqDB search
MSTIYDFSALDLNGEEQALDAFRGRVLLVVNVASQCGFTPQYAGLEALYRDYHAAGLSVL
GFPCDQFGHQEPGDEAAIRDFCTTQYGVTFPMFAKIEVNGPDAHPLYRWLKGEKPGVLGT
EAIKWNFTKFLVGRDGQVIKRYAPTDKPSALKDDILRACEADT
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgatctacgatttttccgccctggacttgaacggcgaagagcaggcgctggac
gcgtttcgcggccgggtgctgctggtggtgaacgtggcttcgcagtgcgggttcacgccc
cagtatgccgggctggaggcgctgtaccgcgattaccatgcggccggcctgtcggtgcta
gggttcccgtgcgaccagttcggccaccaagaacccggtgacgaggctgccattcgcgat
ttctgcacgacgcaatatggcgtcacgttcccgatgttcgccaagatcgaagtcaacggc
cccgacgcccacccgctgtaccgctggctgaagggtgaaaaacccggcgtgctgggcacc
gaggccattaagtggaacttcaccaagttcctggtgggccgcgacggccaggtcatcaag
cgctacgcgccgacggacaagccttcggccctgaaagacgacattctgcgcgcctgcgaa
gcggacacctga

DBGET integrated database retrieval system