KEGG   Bordetella petrii: Bpet2603Help
Entry
Bpet2603          CDS       T00637                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bpt  Bordetella petrii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Bpet2603
Enzymes [BR:bpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Bpet2603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2723963..2724751)
Genome map
AA seq 262 aa AA seqDB search
MSDYISQGKDVLRRRVDREIEERAAPQAAWSAAQKMALACRMLAAQGHWHGGLAGQITAR
GEAPGTILTLPFGVGADEARASELILIDEDINPLDGKSLPNPANRFHAWVYRHRPEVQCI
VHTHPPAVSALSMVGEPLVVAHMDATPFFDDCAYLPQWPGLPIGDDEGEIISEALGDKRA
ILLANHGMLTAGKSIEEATVMAIWLEQVAALQLRARAIGPVKPVPAELARESHDFLVKPK
ILALTFAYFARRALREAPDCIE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattacatttcccagggcaaggatgtcctgcgccgccgcgtcgatcgcgagatc
gaagagcgcgcggctccccaggcggcctggtcggccgcccagaaaatggcgctggcctgc
cgcatgctggccgcgcaagggcactggcacggcggtcttgcgggtcagattacggcgcgt
ggcgaggcgccgggtacgatcctgacgctgccgttcggcgtgggcgccgatgaggcgcgt
gccagcgagctgatcctgatcgacgaggacatcaatccgctggacggcaagtctttgccc
aacccggccaaccgctttcacgcctgggtgtaccggcaccggcccgaggtgcagtgcatc
gtgcacacgcatccgccggcggtgtcggcgttgtcgatggtgggcgagccgctggtggtg
gcgcacatggacgccacgcctttctttgacgactgcgcctatttgccgcaatggccgggc
ctgcccattggcgacgatgaaggcgagatcatctcggaggcgctgggcgacaagcgcgcc
attctgctggccaaccacggcatgctcacggccggcaagtcgatcgaggaagccacggtc
atggcgatctggctggagcaggtcgccgcgctgcaattgcgcgcgcgcgcgatcggcccg
gtcaagccggtgcccgccgaactggcgcgcgagtcgcacgatttcctggtcaagccgaag
atcctggcgctgacgtttgcctatttcgcccgtcgcgcgttgcgcgaggcgcccgactgc
atcgaataa

DBGET integrated database retrieval system