KEGG   Bordetella petrii: Bpet3251Help
Entry
Bpet3251          CDS       T00637                                 

Gene name
aceA
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bpt  Bordetella petrii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bpt01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bpt00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3408582..3409907)
Genome map
AA seq 441 aa AA seqDB search
MSNRETEIRNLQKDWAENTRWQGIKRAYSAEDVIRLRGSVAVEHTLARRGATRLWELMHS
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPQVVR
RINNALSRCDQIQWMEGKNPGDEGYIDYYAPIVADAEAGFGGVLNAFELMKAMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTREAVSKLVSARLAADVMGTPTVLLARTDADAADLVT
SDVDANDRPFITGERTVEGFFRTRAGIDQAISRGLAYAPYADLIWCETSTPNLEYARKFA
EAIHRQFPGKLLAYNCSPSFNWKKNLDDATVAKFQRELGAMGYKFQFITLAGFHALNYGM
FELAHGYARRQMSAFVELQQKEFAAAELGFTAVKHQREVGTGYFDAVTQTIEGGQSSTTA
LTGSTEEAQFEQGEKAQACAA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgcgaaaccgaaatccgcaatctgcagaaagactgggctgaaaacacccgg
tggcagggcatcaagcgcgcctacagcgccgaagacgtgatccgcctgcgcggttcggtc
gccgtcgagcacaccctggcgcgccgcggcgccactcgtctgtgggaactgatgcacagc
gaacccttcgtcaattcgctgggtgcgctgaccggcaaccaggccatgcagcaggtcaag
gccggcctgaaggccatctacctgtcgggctggcaggtggcgggcgacgccaacctggcg
ggcgaaatgtaccccgaccagtcgctgtacccggccaattcggtgccgcaggtggtccgc
cgcatcaacaacgccctgtcgcgctgcgaccagatccaatggatggaaggcaagaatccg
ggcgacgaaggctacatcgattactacgcgcccatcgtggccgatgccgaggccggcttc
ggcggcgtgctcaacgccttcgagctcatgaaagccatgatcgaggcgggcgcggccggc
gtgcatttcgaagaccagctggcgtctgtgaagaagtgcggccacatgggcggcaaagtg
ctggtgcccacccgggaagccgtgtctaagctggtgtcggcgcgcctggcggccgacgtc
atgggtacgcccaccgtgctgctggcgcgcaccgacgccgacgcggccgacctggtcacc
agcgacgtcgacgccaacgaccgccccttcatcacgggcgagcgcacggtcgagggcttc
ttccgcacccgggccggcatcgaccaggccatctcgcgcggtctggcctacgcgccttat
gccgacctgatctggtgcgaaacctcgacgcccaacctggaatacgcgcgcaagttcgcc
gaagccattcatcgccagtttcccggcaagctgctggcctataactgctcgccgtcgttc
aactggaagaagaacctggacgacgccacggtggccaagttccagcgcgagctgggcgcc
atgggctacaagttccagttcatcacgctggcaggcttccacgcgctgaactacggcatg
ttcgaactggcgcacggctacgcgcgccgccagatgagcgcgttcgtcgaactgcagcag
aaggaattcgcggcggccgaactgggcttcaccgcggtcaagcaccagcgcgaagtcggc
acgggttatttcgatgcggtcacccagaccatcgaaggcggacagtcgtccaccacggcg
ttgaccggctcgaccgaagaggcgcagttcgagcaaggcgaaaaagcgcaggcgtgcgcc
gcctga

DBGET integrated database retrieval system