KEGG   Bordetella petrii: Bpet3251Help
Entry
Bpet3251          CDS       T00637                                 

Gene name
aceA
Definition
(GenBank) aceA
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bpt  Bordetella petrii
Pathway
bpt00630  Glyoxylate and dicarboxylate metabolism
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01120  Microbial metabolism in diverse environments
bpt01200  Carbon metabolism
Module
bpt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bpet3251 (aceA)
Enzymes [BR:bpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bpet3251 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-ProteinID: CAP43593
UniProt: A9IUW1
Position
complement(3408582..3409907)
Genome map
AA seq 441 aa AA seqDB search
MSNRETEIRNLQKDWAENTRWQGIKRAYSAEDVIRLRGSVAVEHTLARRGATRLWELMHS
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPQVVR
RINNALSRCDQIQWMEGKNPGDEGYIDYYAPIVADAEAGFGGVLNAFELMKAMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTREAVSKLVSARLAADVMGTPTVLLARTDADAADLVT
SDVDANDRPFITGERTVEGFFRTRAGIDQAISRGLAYAPYADLIWCETSTPNLEYARKFA
EAIHRQFPGKLLAYNCSPSFNWKKNLDDATVAKFQRELGAMGYKFQFITLAGFHALNYGM
FELAHGYARRQMSAFVELQQKEFAAAELGFTAVKHQREVGTGYFDAVTQTIEGGQSSTTA
LTGSTEEAQFEQGEKAQACAA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgcgaaaccgaaatccgcaatctgcagaaagactgggctgaaaacacccgg
tggcagggcatcaagcgcgcctacagcgccgaagacgtgatccgcctgcgcggttcggtc
gccgtcgagcacaccctggcgcgccgcggcgccactcgtctgtgggaactgatgcacagc
gaacccttcgtcaattcgctgggtgcgctgaccggcaaccaggccatgcagcaggtcaag
gccggcctgaaggccatctacctgtcgggctggcaggtggcgggcgacgccaacctggcg
ggcgaaatgtaccccgaccagtcgctgtacccggccaattcggtgccgcaggtggtccgc
cgcatcaacaacgccctgtcgcgctgcgaccagatccaatggatggaaggcaagaatccg
ggcgacgaaggctacatcgattactacgcgcccatcgtggccgatgccgaggccggcttc
ggcggcgtgctcaacgccttcgagctcatgaaagccatgatcgaggcgggcgcggccggc
gtgcatttcgaagaccagctggcgtctgtgaagaagtgcggccacatgggcggcaaagtg
ctggtgcccacccgggaagccgtgtctaagctggtgtcggcgcgcctggcggccgacgtc
atgggtacgcccaccgtgctgctggcgcgcaccgacgccgacgcggccgacctggtcacc
agcgacgtcgacgccaacgaccgccccttcatcacgggcgagcgcacggtcgagggcttc
ttccgcacccgggccggcatcgaccaggccatctcgcgcggtctggcctacgcgccttat
gccgacctgatctggtgcgaaacctcgacgcccaacctggaatacgcgcgcaagttcgcc
gaagccattcatcgccagtttcccggcaagctgctggcctataactgctcgccgtcgttc
aactggaagaagaacctggacgacgccacggtggccaagttccagcgcgagctgggcgcc
atgggctacaagttccagttcatcacgctggcaggcttccacgcgctgaactacggcatg
ttcgaactggcgcacggctacgcgcgccgccagatgagcgcgttcgtcgaactgcagcag
aaggaattcgcggcggccgaactgggcttcaccgcggtcaagcaccagcgcgaagtcggc
acgggttatttcgatgcggtcacccagaccatcgaaggcggacagtcgtccaccacggcg
ttgaccggctcgaccgaagaggcgcagttcgagcaaggcgaaaaagcgcaggcgtgcgcc
gcctga

DBGET integrated database retrieval system