KEGG   Bordetella petrii: Bpet3253Help
Entry
Bpet3253          CDS       T00637                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bpt  Bordetella petrii
Brite
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Bpet3253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3411077..3412078)
Genome map
AA seq 333 aa AA seqDB search
MSKQQILWVTAIMAGLWAQPAPAQQQEPIQPIEPAVITEPAKVELGKKLFFDPRLSKSGA
ISCNSCHNLSMGGADNLKASIGHNWQQGGINSPTVLNSSLNIAQFWDGRAKDLREQAGGP
IANPAEMASSHELAIQVLSSIPGYRAEFKQAFGTDAITIDEVTQALAAFEETLVTPNARF
DQWLRGDAKALTVQELAGYNLFKSSGCVACHNGPAAGGNSFQKMGLVTPYQTANPAEGRA
AVTGQDADRFMFKVPTLRNVALTYPYFHDGEAATLAEAVDVMGRLQLGRTFLPEENGQIV
AFLKTLTGEQPVIKLPALPPSSDATPRPQPFNP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcagcaaattctttgggttaccgcgatcatggctggattgtgggcgcaaccg
gcgccggcgcagcagcaggagcccatccagcctatcgagccggccgtcattaccgagccc
gccaaggtcgagttgggcaagaagctgtttttcgatccgcgcctgtcgaagtctggcgcc
atctcgtgcaactcgtgccacaacctcagcatggggggggccgacaacctcaaggcatcc
atcggacacaactggcagcagggcggcatcaattcacccacagtgctcaattccagcctg
aacatcgcgcaattctgggacggccgcgccaaagacctgcgcgagcaggccggcggcccc
atcgccaaccctgccgaaatggcatcgtcgcacgaactggccatccaggtgctgagctcc
attcctggctaccgggctgaattcaaacaggccttcggcaccgatgccatcaccatcgac
gaagtcacgcaagcgctggccgccttcgaagaaaccctggtcacgcccaacgcgcgtttc
gaccaatggctgcgtggcgacgccaaggctcttaccgtgcaagaattggccggatacaac
ctgttcaagagcagcggctgcgtggcctgtcacaatggccccgcggccggcggcaactcg
ttccagaaaatggggctggtcacgccttaccagacggccaacccggccgaaggccgcgcg
gccgtcacgggccaggacgccgaccgtttcatgttcaaggtgcccacgctgcgcaacgtg
gcgctgacttatccgtacttccacgatggcgaggccgccaccctggccgaggccgtcgac
gtcatgggccggctgcagctcgggcgcacctttttgcccgaagaaaacggccagatcgtg
gcattcctgaagacccttaccggcgaacagcccgtcatcaagctgcccgcgttgccgcct
tcctcggacgccaccccgcggccgcagcccttcaatccgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system