KEGG   Bordetella petrii: Bpet3276Help
Entry
Bpet3276          CDS       T00637                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
bpt  Bordetella petrii
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bpt00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bpt00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3436380..3437723)
Genome map
AA seq 447 aa AA seqDB search
MRRPPLPRLLPRSLPMTALDSSPLARGARPPEGDAAPEGEAAAEHAGLMARLSRLWNSGR
LPGTAEILPLFQARLTDVAANKLARSWCGAYAAADSKRRRELLAGLAQVSAGLEPRGDQG
QRLFKRFNALPDGLRFLVALRADMLRWRKQVAGLQALDKDLEGLLSAWFDVGLLELRPLT
WDSPASLLEKLIIYEAVHEIRSWDDLRHRVASDRRCYAYFHPQMPDVPLIFVEVAFATQM
ADNVQALLDMGAPPQDLDKARWAIFYSISNTQPGLRGISFGNFLLKRVIERLLEEVPKLR
SFATLSPIPGLADWLSRLSAQEVEAIVRDKARTRAGAPDGARWVARLAKAATGKPSEVVQ
RAGLRLAAHYLLSMKNGQPLDPVARFHLGNGARIERLNWAADTSPKGLAQSCGMMVNYLY
DLDDLDANLVQLGEGKPRVSRGIARIG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtccccctcttccccgtctcttacccaggagcctgcccatgaccgccctagac
tccagcccgctcgcgcgcggcgcccggccgcctgagggcgatgccgcgccggaaggcgag
gccgccgccgaacacgccggcctcatggcccggctgagccgcctgtggaacagcggccgg
ctgcccggcaccgccgagattctgccgctgttccaggcccgcctgaccgacgtggccgcc
aacaaactggcgcgcagctggtgcggcgcctacgccgcggccgacagcaagcgccgccgc
gaactgctggccggcctggcgcaggtaagcgccggcctggagccgcgcggcgaccagggg
caaaggctgttcaagcgcttcaatgccttgcccgacggcctgcgcttcctggtggccctg
cgcgccgacatgctgcgctggcgcaagcaggtagcggggctgcaggctctggacaaagac
ctggaaggcctgctgtcggcctggttcgacgtgggcctgctggaactgcgtccgctgacc
tgggattcgccggcctcgttgctggaaaagctgatcatctacgaagccgtgcacgagatc
cgctcgtgggacgacctgcgccaccgggtagcgtccgaccgccgctgctacgcctatttc
catccgcagatgcccgacgtgccgctgattttcgtcgaggtggccttcgccacgcagatg
gccgacaacgtgcaggcgctgctcgacatgggggcgccgccgcaggacctggacaaggcg
cgttgggcgatcttctattccatatcgaacacgcagccgggcctgcgcggcatcagcttc
ggcaacttcctgctcaagcgcgtcatcgaacgcctgctcgaagaagtgcccaagctgcgc
tcgttcgccacgctgtcgcccattcccggcctggccgattggctgtcgcgcctgagcgcg
caagaggtcgaagccattgtgcgcgacaaggcccgcacccgcgctggcgcgcccgatggc
gcccgctgggtggcgcggctggccaaggccgccacaggcaagccgtccgaagtggtgcag
cgcgcgggcctcaggctggcggcacactacctgctgtccatgaagaacggccagccgctg
gacccggtggcgcgctttcacctgggcaacggcgcgcgcatcgagcgcctgaactgggcg
gccgatacgtcgcccaagggcctggcgcagtcgtgcggcatgatggtcaattatctgtac
gacctggacgacctggacgcgaacctggtccagctgggcgaaggcaagccgcgcgtgagc
cgcggcattgcgcggatcgggtag

DBGET integrated database retrieval system