KEGG   Bordetella petrii: Bpet3411Help
Entry
Bpet3411          CDS       T00637                                 

Gene name
fadB2
Definition
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3-hydroxybutyryl-CoA epimerase (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bpt  Bordetella petrii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpet3411 (fadB2)
   01212 Fatty acid metabolism
    Bpet3411 (fadB2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bpet3411 (fadB2)
   00650 Butanoate metabolism
    Bpet3411 (fadB2)
  Lipid metabolism
   00071 Fatty acid degradation
    Bpet3411 (fadB2)
   01040 Biosynthesis of unsaturated fatty acids
    Bpet3411 (fadB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bpet3411 (fadB2)
   00310 Lysine degradation
    Bpet3411 (fadB2)
   00380 Tryptophan metabolism
    Bpet3411 (fadB2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bpet3411 (fadB2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bpet3411 (fadB2)
   00281 Geraniol degradation
    Bpet3411 (fadB2)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Bpet3411 (fadB2)
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Bpet3411 (fadB2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bpet3411 (fadB2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Bpet3411 (fadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3596692..3598671
Genome map
AA seq 659 aa AA seqDB search
MNTPMPHGWRHWRLERRTDGLAWLTFDRAGAAVNALSAEVMAELAAVLDALQADPPAGLV
IHSGKAAGFIAGADIDEFAELNSPQQAQALVERGWRLFDRLAAVPYPTLALIHGHCLGGG
LELALACRYRIAVDQPGTSLALPEVMLGIFPGWGGMRRLPAVIGAPAALDMMLTGRPADA
RRAAALGLVDARVPARLAEAAAAQQVRSGKPPRRARGMAGWLGRWPLKLLVARRAHRQIA
ARDPQGHYPAAPAIVTLWSRHDGNALRAPDVVQRILTSDTARNLLRVFRLQERLKANGKP
AAGARPASHVHVVGAGTMGGDIAAWCALKGLTVTLQDQDAARIAPAIGRAAELHARKLKD
PHAARAASDRLIPDPDGAGVARADVVIEAITEQAEAKQALYRALQPRMKPDALLATNTSS
LSLAALRDGLAQPGQLVGIHFFNPVAKMPLVEVVQAGPDELGAQARACAFVGQIGKLPLP
VRDAPGFLVNAVLAPYMLEAMRCVDAGLAPETVDLAMTDFGMPMGPLELADTVGLDIAMA
AGRQLAGQDEPPRCLAERLARGELGRKTGRGFYAWHDGKARKNNASAPPPGLAQRLVQPL
VERAAQLVPDGVVADADLADAGVIFGTGFAPFTGGPLHYRATAGPTSAAGHAAPAPSNP
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccctatgccccatggctggcgccactggcggcttgagcgccgcaccgacggg
ctggcctggcttaccttcgatcgcgccggcgccgccgtcaacgccctctcggcagaagtc
atggccgaactggcggccgtgctcgacgcgctgcaggccgacccgccggcggggctggtc
atccactccggcaaggcagccggcttcattgccggcgccgacatcgacgaattcgccgaa
ctgaactcgccgcagcaggcccaggcgctggtcgagcgcggctggcgcctgttcgaccgg
ctggccgccgtgccttatcccacgctggcgctcatccacggccactgcctgggcggcggc
ctggaactggcattggcctgccgctaccgaatagcggtcgaccagcccggcacctcgctg
gcgttgcccgaggtcatgctgggcatattccccggctggggcggcatgcgccggctgccg
gccgtgatcggcgctcccgcggcgctcgacatgatgcttaccggccgcccggccgacgcc
cgccgcgccgccgcgctgggcctggtcgacgcgcgggtgccggcgcgcctggccgaggcc
gcggccgcccagcaggtgcgcagcggcaagccgccgcgccgggcgcgcggcatggcgggc
tggctcggccgctggccgctcaagctgctggtggcgcgccgcgcccaccggcagatcgcc
gcccgagacccgcaaggacattacccggcggcaccggccatcgtcacgctgtggtcgcgg
catgacggcaatgcgctgcgcgcgcccgatgtggtgcagcgcattctcacctccgacacc
gcccgcaatctgctgcgcgtgttccgcctgcaagagcgcctgaaagccaacggcaagccg
gccgccggcgcgcggccagccagccacgtgcatgtggtgggcgccggcaccatgggcggc
gacatcgccgcgtggtgtgccctcaagggccttaccgtcaccctgcaagaccaggacgcc
gcccgcatcgctccggccatcggccgcgccgccgaactgcacgcgcgcaagctgaaagac
ccgcacgccgcgcgggccgcgtccgatcgccttattcccgaccccgacggcgccggcgtg
gcgcgcgccgatgtggtcatcgaagccattaccgagcaggccgaggccaagcaggcgctg
taccgcgccttgcaaccgcgcatgaaacccgacgcgctgctggccaccaacacgtccagc
ctgtcgctggcggccctgcgcgacggcctggcgcaacccggccaactggtcggcattcat
ttcttcaacccggtggccaagatgccgctggtcgaagtggtacaggccggccccgacgag
ctcggcgcgcaggcgcgcgcctgcgccttcgtgggccagatcggcaagctgccgttgccg
gtgcgcgacgcgcccgggttcctggtgaacgcggtgctggccccctacatgcttgaagcc
atgcgctgcgtcgacgccggcctggcgccggaaaccgtcgacctcgccatgaccgatttc
ggcatgcccatgggcccgctcgaactggccgacaccgtgggcctggatatcgccatggcg
gccggccgccaactggcgggccaggatgaaccgccccgctgcctggccgagcgcctggcg
cgcggcgagctgggccgcaaaacgggccgtggcttctacgcctggcacgacggcaaggcg
cgcaagaacaacgccagcgcgccgccgcccggcctggcgcagcgcctggtgcagccgctg
gttgaacgcgccgcgcaactggtgcccgacggcgtcgtggccgatgccgacctggccgac
gccggggtgatcttcggcacaggcttcgcgccgttcaccggcggcccgctgcactaccgt
gccacggccggcccaacatccgccgccggccacgctgcgccggcgccatccaatccataa

DBGET integrated database retrieval system