KEGG   Bordetella petrii: Bpet3517Help
Entry
Bpet3517          CDS       T00637                                 

Gene name
attL
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bpt  Bordetella petrii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bpet3517 (attL)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpet3517 (attL)
  Lipid metabolism
   00071 Fatty acid degradation
    Bpet3517 (attL)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bpet3517 (attL)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bpet3517 (attL)
   00626 Naphthalene degradation
    Bpet3517 (attL)
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bpet3517 (attL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3711760..3712917)
Genome map
AA seq 385 aa AA seqDB search
MTNFQFTTVPTLTVEFGAARRLGGLLRERYAATRLCLVTDAFLHASGLLAPALADLQAHG
WQVTVIDDVVADPPDHVVLKAAQRARDCRAEVVLGLGGGSSMDVAKLLAVLCGSGQPLAD
MYGIGKVQGPRLPLVLMPTTAGTGSEVTAISIVTTGETTKSGVVSPFLMADLAILDAELT
LGLPPAATAATGIDAMVHAIEAYTSARLKNPISDMLARQALALLSANQLRACRDGGDRAA
REAMLLGATLAGQAFSNAPVAAVHALAYPLGGHFHVPHGLSNALVLVHVLRFNRQAALPL
YAELAAVLPGEGCPAEPAEAADYFIERMETLVRETGIPRTLREVGVAERDLPMLAADAML
QQRLLVNNPRPLAEADALAIYQAAF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacttccagttcacgaccgtcccgacccttaccgtggaattcggcgcagcccgc
cggttgggcggtctgctgcgcgagcgctatgccgccacccggctctgtctggtgaccgat
gcgtttctgcacgccagcgggttgctggctccggcgctggccgacctgcaggcgcacgga
tggcaggtcacggttatcgacgacgtcgtggccgacccgcccgaccacgtcgtgctcaaa
gccgcgcaacgcgcgcgcgattgccgtgccgaggtagtgctgggcctgggcggcgggtcg
tcaatggacgtggccaagctgctggccgtgctgtgcgggtcgggccagccgctggccgac
atgtatggcatcggcaaggtccagggcccccggctgccgctggtgttgatgcctaccacg
gcgggcactggctccgaggtcacggccatctccattgtgaccacgggtgaaaccaccaag
agcggggtcgtgtccccgttcctgatggccgacctggccatcctggatgccgagctgacc
ctgggcctgccgcccgcggccaccgccgccaccggcattgatgccatggtgcacgccatc
gaggcctatacatcggcgcgcctgaagaacccaatttccgacatgctggctcggcaggcc
ctggcgctattgtcggccaaccagttgcgcgcctgccgcgacggcggcgaccgcgcggcc
cgcgaagcaatgctgctgggcgccacgctggccgggcaggcgttttccaacgcgccggtg
gcggccgtacatgcactggcttatccgttgggcggccatttccatgtgccgcacggacta
tccaatgcgctggtgctggtacacgtgttgcgctttaaccggcaagcggctctgccgctg
tatgccgaactggccgccgtgctgccgggtgaaggctgtcccgccgagccggccgaggcg
gcggattatttcatcgaacgcatggagaccctggtgcgcgaaaccggcatcccgcgcacg
ctgcgcgaagtcggcgtggccgagcgcgatctgcccatgctggcggccgacgccatgctg
caacagcggttgctggtgaacaacccgcgcccgctcgccgaggccgacgccctggcgatt
taccaggcggcgttctag

DBGET integrated database retrieval system