KEGG   Bordetella petrii: Bpet4021Help
Entry
Bpet4021          CDS       T00637                                 

Gene name
pgm
Definition
hypothetical protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bpt  Bordetella petrii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpet4021 (pgm)
   00030 Pentose phosphate pathway
    Bpet4021 (pgm)
   00051 Fructose and mannose metabolism
    Bpet4021 (pgm)
   00052 Galactose metabolism
    Bpet4021 (pgm)
   00500 Starch and sucrose metabolism
    Bpet4021 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    Bpet4021 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    Bpet4021 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bpet4021 (pgm)
Enzymes [BR:bpt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bpet4021 (pgm)
    5.4.2.8  phosphomannomutase
     Bpet4021 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4246466..4247857
Genome map
AA seq 463 aa AA seqDB search
MDHIARYPESVFKAYDIRGTVPSPLDAGFARALGRALADQAREQGVGALVVGRDGRLSSP
ELSQALQDGILEGGIDTLDIGQVPTPLVYYAAYTQGTGSGVAITGSHNPPQYNGFKMMMA
GKALYGPGVQALRAAMNAPDAAPAARRGSRRELDLMGEYIERIVGDVKLARPLKIAIDCG
NGVAGAVAPQLFRALGCQVDELYCEVDGTFPNHHPDPADPHNLQDLIDHLARTDCEIGLA
FDGDGDRLGVVTKSGQIIWPDRQLILFARDVLQRCPGATIIYDVKCSRHVGLAVQEAGGQ
PLMWQTGHSLVKAKLAETGAPLAGEMSGHIFFKERWYGFDDGLYTGARLLEIVSRQANPS
QLLEALPQALSTPELKLEMAEGEPYALVRALQKQGKFDDALRVVTIDGVRAEYADGFGLA
RASNTTPVVVLRFEADTPEALARIQDDFRGQLLRLAPGAALPF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttggatcatatcgcccgctatcccgaatcggtcttcaaggcttacgacatccgcggcacg
gtgccgtcccccctggacgccgggtttgcccgcgcgctggggcgcgcactggccgaccag
gcgcgcgaacagggcgtcggcgccctggtggtgggccgcgacggccgcctcagcagtccc
gaactgtcgcaagcgctgcaagacggcattctggagggcggcatcgacaccctcgacatc
ggccaggtgcccacgccgctggtgtactacgcggcctatacccagggcaccggctcgggc
gtggccattacgggcagccacaaccctccccagtacaacggcttcaaaatgatgatggcc
ggcaaggccctgtacggccccggggtgcaggcgttgcgcgccgccatgaatgcccccgac
gccgcgcccgcggcccgtcgcggcagccgccgcgagctcgacctgatgggcgagtacatc
gagcgcatcgtgggcgacgtcaagctggcgcgccccctcaaaatcgccatcgactgcggc
aacggcgtggccggggcggtggcgccgcaactgttccgggccctgggctgccaggtcgac
gagctgtattgcgaagtcgacggcacctttcccaaccaccaccccgacccggccgacccc
cacaacctgcaagacctcatcgaccacctggcgcgcaccgactgcgaaatcggcctggcc
ttcgacggcgacggcgaccggctgggcgtggtcaccaagtccgggcagatcatctggccc
gaccgccagctgatcctgttcgcgcgcgacgtgctgcagcgctgtcccggcgccaccatc
atctacgacgtcaagtgcagccgccacgtgggcctggccgtgcaggaagccggcgggcag
cccctgatgtggcaaaccgggcattcgctcgtgaaagccaagctggccgagaccggcgcg
ccgctggctggcgagatgagcggccacattttcttcaaagaacgctggtacggcttcgac
gacggcctgtataccggcgcgcgcctgcttgaaatcgtgtcgcgccaggccaacccgtcg
caactgctcgaagccttgccacaggctctgtccacgcccgaactcaagctcgaaatggcc
gaaggcgagccctacgcgctggtgcgggcattgcagaaacaaggcaagttcgacgacgcc
ctgcgcgtggtcaccatcgacggcgtgcgcgccgaatatgccgacggcttcggcctggcg
cgcgcctctaacaccacgccggtggtggtgctgcgcttcgaggccgacacgcccgaggcg
ctggcgcgcatccaggacgacttccgcgggcaactgctgcgcctcgcccctggcgcggcc
ctgcccttctga

DBGET integrated database retrieval system