KEGG   Bordetella petrii: Bpet4237Help
Entry
Bpet4237          CDS       T00637                                 

Gene name
res
Definition
type III restriction enzyme (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bpt  Bordetella petrii
Brite
Enzymes [BR:bpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Bpet4237 (res)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4489211..4492216
Genome map
AA seq 1001 aa AA seqDB search
MKLHFEPNLDYQMQAIEAVCDLFRGQEVCRTEFTVTMKLPDEVQMSLGVAQSDLGVGNRL
TLLDDELLKNLADIQLRGGLPPSGSLTSGDFTVEMETGTGKTYVYLRSIFELNKRYGFSK
FVIVVPSVAIKEGVYKTLQITEEHFKGLYAGVPFDYFLYDSGKPGPVRNFATSSNIQIMV
VTVGAINKKDVNNLYKETEKTGGEKPIDLIKATRPIIIVDEPQSVDGGLEGRGKEALDAM
NPLCTLRYSATHVDKHHMVFRLDAVDAYERKLVKQIEVASATVEDAHNKPFVRLVKVENK
RGRISAKVELDKQTATGVQRTEVTVSDGDDLQQSADGRAIYADFRVGEINTAKGEAFMEL
RCPGGEVFLQPGQAHGDVDALAVQREMIRRTIKEHLDKEKHLRPLGIKVLSLFFIDAVDK
YRQYDADGQPVKGVYAQMFEEEYRRAAKLPAYQSLFAEIDLESAAEEVHNGYFSIDKKGG
WLDTAENNAGNRENAERAYNLIMKEKEKLLSFSTPLKFIFSHSALKEGWDNPNVFQICTL
RDIQTERERRQTIGRGLRLCVNQDGERVRGFEVNTLTVVATENYEQFAENLQKEIEKDTG
IRFGIVEQHQFAAIAVTGADGHAAPLGIEQSKALWEHLKAAGHIDAKGKVQDSLKTALKN
GTLELPAEFDAQKAQIAEVLRKVSGRLDIKNADERRQVPLRKGKDGKVVYLSDEFKALWD
RIKHQTTYRVQFDNAKLVTDCIAALQKAPVIAKARLQWRKADISIGKAGVAATEKAGATT
VVLDEADIELPDLLTDLQDRTQLTRRTIVSILTGSGRLDDFKRNPQQFIELTAETINRCK
RLALVDGIKYQKLGDQHVYAQELFEKEELTGYLKNMLLDTQKSIYEHVVYDSTTERDFAD
GLEKNDAIKLYAKLPGWFKVPTPLGTYNPDWAVLVEEDGTQHLYFVVETKSSLFTDDLRD
KESAKIECGKAHFTALGVGENPARYVVARSVGDLLTEAAKG
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccacttcgagcccaacctcgactatcagatgcaggccatcgaggccgtgtgc
gatcttttccgtggtcaggaggtctgccgcaccgaatttacggtgaccatgaaactgccc
gatgaggtgcagatgtcactgggtgtggcgcagtccgaccttggcgttggcaaccgcttg
accctgctggacgatgaactgctcaagaacctcgcggacatccagttgcgcggtggcctg
ccgccttccggctcgctgacttccggcgacttcacggtggaaatggagaccggcaccggt
aagacctatgtatacctgcgctcgatcttcgagctgaacaagcgctacggtttcagcaag
ttcgtgatcgtggtgccctcggtggcgatcaaggaaggcgtctacaagaccctgcaaatc
accgaggaacacttcaaggggctctacgcgggcgtgcccttcgattacttcctgtacgac
tcgggcaagcccgggccggtgcgcaatttcgccactagttccaacatccagatcatggtg
gtgacggtgggcgccatcaacaagaaggatgtgaacaacctctacaaagagaccgagaag
acgggcggcgagaagcccatcgacctgatcaaggccacccggccgatcatcatcgtggat
gaaccgcaaagtgtggacggcggccttgaaggacgcggcaaggaagcgctggatgccatg
aacccgctctgcacgctgcgctattcagctacccatgtggacaagcaccacatggtgttc
cgcctggatgccgtggatgcttatgagcgcaagctggtcaagcagatcgaggtggcgtcg
gccacggtggaggatgcgcacaacaagcctttcgtgcgcctggtgaaggtggaaaacaag
cgcggccgcatcagcgccaaggtcgagctggataaacagaccgccactggcgtgcaaagg
actgaggtgacggtcagcgatggcgacgaccttcagcagagcgccgatggccgtgcgatc
tacgccgattttcgggtgggcgagatcaatacggccaagggcgaagcgttcatggagctg
cgctgccccggcggcgaagtgtttttgcagccgggtcaggcccacggtgatgtggatgcg
ctggccgtgcaacgcgagatgatccgccgcacgatcaaggagcatctggacaaggaaaag
cacctgcgtccattggggatcaaggtgttgagcctgttcttcatcgacgcggtggacaag
taccgtcagtacgatgcggacggccagccggtcaagggcgtgtatgcgcagatgttcgag
gaagaatatcgccgtgccgccaagttgccggcctaccagagtttgtttgccgagatcgac
ctggagtccgccgccgaagaagtgcacaacggctatttctccatcgacaagaagggcggc
tggcttgataccgccgagaacaatgcgggtaaccgggagaatgccgaacgcgcctacaac
ctgatcatgaaagagaaggagaagctgctgtccttcagcacgccgctgaagttcatcttc
tcccactccgccctcaaggaaggctgggacaaccccaacgtgttccagatttgcaccttg
cgcgacatccagaccgagcgcgagcgccgccagaccattggtcgcggcctgcgcctgtgc
gtcaaccaggatggcgagcgggtacggggcttcgaggtcaacaccctgaccgtggtggcc
acggaaaactacgaacagtttgccgaaaacctgcagaaggaaatcgagaaagacacaggc
atccgctttggcattgtggagcagcatcaatttgccgccattgccgtgactggcgctgat
gggcacgccgcaccgctgggcatcgagcaatcgaaggcactgtgggagcacctgaaagcc
gccggccatatagatgccaaaggcaaggtgcaggattcactgaaaacggcgctgaaaaac
ggcaccttggaactgccggccgagtttgatgcgcagaaagcccagattgctgaagtgctg
cgcaaggtgtcgggccggctggacatcaagaatgccgatgagcgcaggcaagtgccgctg
cgcaagggtaaggatggcaaggtcgtttatctgagcgacgagttcaaggcactgtgggac
cgcatcaagcaccagacaacgtaccgcgtgcagttcgataacgccaagctggtgacggat
tgcatcgcagcgttgcagaaggccccggtgattgccaaagcacggctgcaatggcgcaag
gccgacatctctatcggcaaggcgggtgtcgccgcgacggagaaagcgggcgcgacgacc
gtggtgctggacgaggcggatattgagctgccggatttgctgaccgaccttcaggatcgc
acccagctcacccggcgcaccatcgtcagcatcctgacgggaagcggccgcctggacgac
ttcaagcgcaatccgcagcagttcatcgaattgaccgccgagaccattaaccgctgcaag
cgcttggccctggtcgatggtatcaagtaccagaagctcggcgaccagcatgtctatgcg
caggagctgttcgagaaggaggagctcaccggctatctcaagaacatgctgctggatacc
cagaagtcgatctacgagcacgtggtgtacgactcgaccacagagcgggacttcgccgat
gggctggagaagaacgacgccatcaagctctatgccaagctgccaggctggttcaaagtg
cccacgccgctgggtacctacaaccccgactgggccgtgttggtggaagaagacggcacc
cagcacctgtactttgtggtggaaaccaagagcagcctgtttaccgacgatttgcgcgac
aaggaaagcgccaagatcgaatgcggcaaggcgcatttcactgcgctgggggttggtgag
aaccctgcccggtatgtggttgcgcgctcggttggtgatcttttgaccgaggcggcaaag
gggtag

DBGET integrated database retrieval system