KEGG   Bordetella petrii: Bpet4694Help
Entry
Bpet4694          CDS       T00637                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpt  Bordetella petrii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpet4694 (gpmA)
   01230 Biosynthesis of amino acids
    Bpet4694 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpet4694 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Bpet4694 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bpet4694 (gpmA)
Enzymes [BR:bpt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bpet4694 (gpmA)
Exosome [BR:bpt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bpet4694 (gpmA)
  Exosomal proteins of melanoma cells
   Bpet4694 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4954228..4954980)
Genome map
AA seq 250 aa AA seqDB search
MYKLVLMRHGESQWNLENRFTGWTDVDLTETGREQARKAGELLKKEGYQFDLAYTSVLKR
AIRTLWIALDAMDAMYTPVGISWRLNERHYGNLQGLNKAETAAKYGDEQVLIWRRAYAIA
PEPLPLDDERHPRFDSRYAKIPADQLPATECLQDTVARVLPYWNDSIAPAIRAGRRVLVA
AHGNSLRALIKHLDNISDDDIVGLNIPTGQPLVYELDEALRPIRHYYLGDAAEIEAAMAA
VAAQGKAKKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctgatgcgtcacggcgaaagccagtggaacctggaaaaccgcttc
acgggctggaccgacgtagacctgaccgaaaccggccgcgaacaggcccgcaaggccggc
gagctgctcaagaaagagggttaccagttcgacctggcctatacctcggtgctcaagcgc
gccatccgcacgctgtggatcgcgttggacgccatggacgccatgtataccccggtgggc
atcagctggcgcctgaacgagcgccattacggcaacctgcagggcctgaacaaggccgag
acggccgccaagtatggcgacgaacaagtactgatctggcgccgcgcctacgccatcgcg
cccgagcccctgccgctggacgacgagcgccatccgcgctttgacagtcgctacgccaag
attccggccgaccagctgccggccaccgagtgcctgcaggacaccgtggcccgggtgctg
ccgtactggaacgattcgatcgcgccggccatccgcgccggccgccgggtgctggtggcc
gcgcacggcaacagcctgcgcgccctgatcaagcacctggacaatatctcggacgacgac
atcgtgggcctgaatatccccaccggccagccgctggtgtacgagctcgacgaggcgctg
cgcccgatccgccattattatctgggcgatgccgctgaaatcgaagccgccatggcggcg
gtcgcggcccagggcaaggctaaaaaggactga

DBGET integrated database retrieval system