KEGG   Bordetella petrii: Bpet4866Help
Entry
Bpet4866          CDS       T00637                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bpt  Bordetella petrii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bpet4866 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bpet4866 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    Bpet4866 (glcB)
Enzymes [BR:bpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bpet4866 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5134477..5136657
Genome map
AA seq 726 aa AA seqDB search
MTERIQQDGLQVAAVLHRFIQDEALPAGGIDAPRFWAGFAALVRDLAPRNRALLAERDRL
QRELDTWHRAHPGPVRDLRAYRAFLEQIGYLQPVPGTVRVETANVDAEIAEQAGPQLVVP
MSNARYALNAANARWGSLYDALYGTDAIPPTPGDTGRGYHPQRGQAVIARARAFLDEAVP
LAQGSHADATGYSVDNGQLRVALAQGSTGLAQPEQFAGYQGDAQAPQAILLKHHGLHIEI
QIDRAHSIGATDAAGIKDVVVEAALTTIMDCEDSVAAVDAEDKVQVYRNWLGLMKGDLAE
QVTKGGQTFTRRLNADRVYHAPGGGTLTLHGRSLMFVRNVGHLMTNPAVLDADGNEIPEG
ILDAVVTTLAALPDRASRRNSRAGSIYIVKPKMHGPAEAAFANELFDRVEDLLGLPRHTV
KMGIMDEERRTSVNLKACIQAAAGRVAFINTGFLDRTGDEMHSSMEAGPMMRKGDMKSSA
WIAAYERSNVLVGLDCGLRGRAQIGKGMWAMPDLMAAMLEQKIGHPKAGANTAWVPSPTA
ATLHALHYHQVDVPAVQQQLESTRLASVQDELLDGLLTVPVGNPADWSPDDIRHELENNA
QGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWMRHGIATREQVRDTF
ERMAAVVDRQNAGDPLYQPMAGHFDTSIAFQAACALVFEGLAQPNGYTEPLLHQYRLAFK
ARHNKG
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgtatccagcaagacggcctgcaagtggcggccgtgctccatcgctttatc
caggacgaggccctgcctgccggcggcatcgacgccccacgcttctgggccggcttcgcg
gccctggtacgcgacctggcgccgcgcaaccgcgccctgctggccgagcgtgaccgcctg
cagcgcgagctcgatacctggcaccgcgcccaccccggcccggtgcgcgatctgcgcgcc
taccgcgcgttcctggaacaaatcggctatctgcaacccgtgccgggcaccgtgcgggtc
gagaccgccaacgtcgatgccgaaatcgccgaacaggccggcccgcaactggtggtgccc
atgtccaacgcgcgctacgccctgaacgcggccaacgcccgctggggcagcctgtacgac
gccctgtacggcaccgacgccatcccccccacgccgggcgacaccgggcgcggctatcac
ccgcaacgcggccaggcagtcattgcccgcgcgcgcgccttcctcgacgaagccgtgccg
ctggcgcagggctcgcacgccgacgccaccggctacagcgtcgacaatggccagttgcgc
gtggcgctggcgcagggcagcacgggcctggcgcagccggagcagttcgccggctatcag
ggcgatgcgcaggcgccccaggccatcctgctcaagcatcacggcctgcacatcgaaatc
cagatcgaccgcgcccacagtatcggcgccaccgacgccgccggcatcaaagacgtggtg
gtcgaggctgccctcaccaccatcatggactgcgaagactccgtcgccgccgtcgatgcc
gaagacaaggtgcaggtctatcgcaactggctcggcctcatgaagggcgacctggccgaa
caagtcaccaagggcggccagaccttcacccggcgcctgaacgccgaccgcgtataccac
gcgcccggcggcggcacgctgacgctgcacggccgttcgctgatgttcgtgcgcaacgtg
ggccacctgatgaccaaccccgccgtgctcgatgccgacggcaacgaaattcccgaaggc
attctcgacgcggtggtcactacgctggcggccctgcccgaccgcgccagccgccgcaac
tcgcgcgccggctccatctatatcgtcaagcccaagatgcacggcccggccgaagcggcg
ttcgccaacgaactgttcgaccgcgtcgaagacctgctcggcctgccgcgccacaccgtg
aaaatgggcatcatggacgaagaacggcgcaccagcgtcaacctgaaagcctgcatccag
gccgcggccggccgcgtggcgttcatcaacaccggctttctcgaccgcaccggcgacgaa
atgcattccagcatggaagccggccccatgatgcgcaagggcgacatgaaatccagcgcc
tggatcgccgcctacgaacgcagcaacgtgctggtggggctggactgcggcctgcgcggc
cgcgcccagatcggcaagggcatgtgggccatgcccgacctgatggccgccatgctcgaa
cagaaaatcggccaccccaaggcaggcgccaacaccgcatgggtaccgtcgcccaccgcg
gccaccctgcacgcgctgcactaccaccaggtcgacgtgccggccgtacagcaacagctc
gaaagcacccggctggccagcgtacaagacgaactgctcgacggcctgctgacggtgccg
gtaggcaacccggccgactggagccccgacgacatccgccacgaactcgagaacaacgcc
cagggcatcctgggctatgtggtgcgctggatcgaccagggcgtgggttgctcgaaagtg
cccgacattaataacgtcggcctgatggaagaccgcgccacgctgcgcatctccagccag
cacatcgccaactggatgcgccacggcatcgccacgcgcgagcaggtgcgcgacaccttc
gaacgcatggccgcggtggtcgaccgccagaacgccggcgatccactctaccaacccatg
gcgggccacttcgatacgtccatcgctttccaggccgcctgcgcgttggtgttcgaaggg
ctggcgcagcccaacggctacaccgagccgctgctgcaccagtaccgcctggccttcaag
gcgcggcacaacaagggctga

DBGET integrated database retrieval system