KEGG   Bordetella petrii: Bpet4940Help
Entry
Bpet4940          CDS       T00637                                 

Gene name
rplN
Definition
(GenBank) 50S ribosomal protein L14
  KO
K02874  large subunit ribosomal protein L14
Organism
bpt  Bordetella petrii
Pathway
bpt03010  Ribosome
Module
bpt_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Bpet4940 (rplN)
Ribosome [BR:bpt03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Bpet4940 (rplN)
  Bacteria
    Bpet4940 (rplN)
  Archaea
    Bpet4940 (rplN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L14 DUF5036
Motif
Other DBs
NCBI-ProteinID: CAP45292
UniProt: A9IHU2
Position
complement(5204568..5204936)
Genome map
AA seq 122 aa AA seqDB search
MIQMQTTLDVADNTGARAVMCIKVLGGSKRRYAGIGDIIKVSVKDAAPRGRVKKGEIYNA
VVVRTAKGVRRKDGSLIRFGGNAAVLLNAKLEPIGTRIFGPVTRELRTERFMKIVSLAPE
VL
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaatgcagaccacgctggacgtggccgacaacaccggtgcgcgtgcagtcatg
tgcatcaaggtgctcggtggctccaagcgccgttatgccggtatcggcgacatcatcaag
gtgagcgtcaaagatgcggccccgcgcgggcgcgtcaagaaaggcgaaatctacaacgcc
gtggtggttcgcaccgccaagggcgtgcgccgcaaagacggttcgctgatccgtttcggt
ggcaacgccgccgtgttgctcaacgccaagctggagcccatcggcacccgcatcttcgga
cccgttacgcgcgaactgcgtaccgagcgcttcatgaagatcgtgtcgttggcccccgaa
gtgctgtaa

DBGET integrated database retrieval system