KEGG   Bordetella petrii: Bpet4940Help
Entry
Bpet4940          CDS       T00637                                 

Gene name
rplN
Definition
50S ribosomal protein L14
Orthology
K02874  
large subunit ribosomal protein L14
Organism
bpt  Bordetella petrii
Pathway
Ribosome
Module
Ribosome, bacteria
Class
Genetic Information Processing; Translation; Ribosome [PATH:bpt03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5204568..5204936)
Genome map
AA seq 122 aa AA seqDB search
MIQMQTTLDVADNTGARAVMCIKVLGGSKRRYAGIGDIIKVSVKDAAPRGRVKKGEIYNA
VVVRTAKGVRRKDGSLIRFGGNAAVLLNAKLEPIGTRIFGPVTRELRTERFMKIVSLAPE
VL
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaatgcagaccacgctggacgtggccgacaacaccggtgcgcgtgcagtcatg
tgcatcaaggtgctcggtggctccaagcgccgttatgccggtatcggcgacatcatcaag
gtgagcgtcaaagatgcggccccgcgcgggcgcgtcaagaaaggcgaaatctacaacgcc
gtggtggttcgcaccgccaagggcgtgcgccgcaaagacggttcgctgatccgtttcggt
ggcaacgccgccgtgttgctcaacgccaagctggagcccatcggcacccgcatcttcgga
cccgttacgcgcgaactgcgtaccgagcgcttcatgaagatcgtgtcgttggcccccgaa
gtgctgtaa

DBGET integrated database retrieval system