KEGG   Bacillus pumilus SAFR-032: BPUM_0029Help
Entry
BPUM_0029         CDS       T00599                                 

Definition
(GenBank) protein sspF
  KO
K06423  small acid-soluble spore protein F (minor alpha/beta-type SASP)
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SASP
Motif
Other DBs
NCBI-ProteinID: ABV60729
UniProt: A8F912
Position
55510..55695
Genome map
AA seq 61 aa AA seqDB search
MGRRRGIMSDEFKYELAKDLGFYDTVKNGGWGEIRARDAGNMVKRAIELAQQHMAQDENQ
R
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
ttgggtagacgccgagggattatgtcagatgagttcaaatacgagctggcgaaggatctt
ggattttatgataccgtcaaaaatggaggctggggagaaattcgagcgcgtgacgcaggt
aatatggtcaaacgtgccattgaattagctcaacagcacatggctcaggatgagaatcaa
cgatag

DBGET integrated database retrieval system