KEGG   Bacillus pumilus SAFR-032: BPUM_0035Help
Entry
BPUM_0035         CDS       T00599                                 

Definition
(GenBank) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00030  Pentose phosphate pathway
bpu00230  Purine metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
bpu01130  Biosynthesis of antibiotics
bpu01200  Carbon metabolism
bpu01230  Biosynthesis of amino acids
Module
bpu_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BPUM_0035
  Nucleotide metabolism
   00230 Purine metabolism
    BPUM_0035
Enzymes [BR:bpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     BPUM_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: ABV60735
UniProt: A8F918
Position
60129..61082
Genome map
AA seq 317 aa AA seqDB search
MSNRYADANLKIFSLNSNPELAKEIADRIGVDVGKSSVKRFSDGEVQINIEESIRGCDCY
VIQSTSAPVNEHIMELLIMVDALKRASAKTVNIVIPYYGYARQDRKAKPREPITAKLFAN
LLETAGATRVIALDLHAPQIQGFFDIPIDNLMAVPILTNYFEQKNLNDIVVVSPDHGGVT
RARKMADRLKAPIAIIDKRRPKPNVAEVMNIIGNIEGKTAILIDDIIDTAGTITLAANAL
VENGAAEVYACCTHPVLSGPAVERITNSKIKELVVTNSIHLTDDKKVGKFIPLSVGPLLA
EAIIRVHEEESVSYLFS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcgttatgctgatgcgaatttaaagatcttctctttgaattcaaaccctgaa
cttgctaaagaaattgccgatcgtatcggagttgatgtaggaaagagctctgttaaacgc
tttagtgacggtgaagtccaaatcaatattgaagaaagtatccgcgggtgtgattgttat
gtcattcaatccactagtgcgccagtgaatgagcacattatggagctgcttattatggta
gatgcactaaaacgcgcttctgcgaaaacggtcaatattgtgatcccttattacggatat
gcacgtcaagatcgtaaggcaaaacctcgtgagccaatcactgcgaagctatttgcgaac
ttacttgaaacagcaggtgctacacgtgtcattgcacttgatcttcatgcgccgcaaatc
caaggtttctttgatattccaatcgataacttaatggctgtgccaatcttaacaaactat
ttcgaacagaaaaacttgaatgatatcgtcgttgtgtctcctgaccacggtggtgtgaca
cgtgcgcgtaaaatggcagatcgtctgaaagcaccaatcgctattatcgacaaacgtcgt
ccaaagccaaacgttgctgaagtcatgaacatcattggtaacattgaaggcaaaacggcg
attctcatcgatgatattattgatacagctggtactattacacttgctgcaaatgcactt
gtggaaaatggagcagctgaagtctatgcttgctgtactcacccagtattgtctggacca
gcagtagaacgtatcacaaactctaaaattaaagaattagttgtgacaaacagtattcac
ttaacagatgacaagaaagttgggaaattcattccgctttcagttgggcctttgcttgca
gaagccatcatccgtgtacatgaagaagaatctgtgagctacctttttagctaa

DBGET integrated database retrieval system