KEGG   Bacillus pumilus SAFR-032: BPUM_0052Help
Entry
BPUM_0052         CDS       T00599                                 

Definition
(GenBank) hypoxanthine phosphoribosyltransferase
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00230  Purine metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BPUM_0052
Enzymes [BR:bpu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     BPUM_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: ABV60752
UniProt: A8F935
Position
78892..79431
Genome map
AA seq 179 aa AA seqDB search
MKQDIEKVLISEEEIQQKVKELGATLTSDYDGEFPLAIGVLKGALPFMADLIKHIDTYLE
LDFMDVSSYGKSTVSSGEVKIIKDLDTSVEGRDILIMEDIIDSGLTLSYLVELFRYRKAN
SIKIVTLLDKPSGRKADIKADYVGFEVPDAFVVGYGLDFAERYRNLPYIGVLKPSVYEG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagatattgaaaaggttttgatctcagaagaagagatccagcaaaaagtgaag
gaactgggtgcaacattaaccagcgattatgatggtgaatttcccctggctattggtgtt
ttgaaaggggctcttccattcatggcagacctgatcaaacacattgatacatatttagaa
cttgattttatggatgtatctagctacggaaaatctaccgtatcttcaggagaagtaaag
atcattaaagatctagatacttctgttgaaggaagagatattttaattatggaagatatc
atcgacagtgggttaactttgagctatctggtagagcttttccgataccgtaaagcaaac
tccataaaaattgtgacattgcttgataaaccaagtggtcgtaaagcagacatcaaagca
gattatgttggatttgaagtaccagatgcatttgttgtcggctatggattggatttcgct
gaacgttaccgaaacctcccgtatattggagtgttaaaaccatctgtttacgagggctaa

DBGET integrated database retrieval system