KEGG   Bacillus pumilus SAFR-032: BPUM_0061Help
Entry
BPUM_0061         CDS       T00599                                 

Gene name
sul
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPUM_0061 (sul)
Enzymes [BR:bpu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BPUM_0061 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64823..65680
Genome map
AA seq 285 aa AA seqDB search
MTQQVIKQPKVIQAKHHTLSYEEKTLVMGILNVTPDSFSDGGKFNQVDKALAHAAQLIED
GAHIIDIGGESTRPGAAFVSEQEELSRVIPVIEKITKELDVPISIDTYKAHVADEAVKAG
ASIINDVWGAKADPQMAHVAAKHNVPIILMHNRPERNYTHLISDMIADLNESVQIAKQAG
VRDDMIILDPGIGFAKNKEDNLMVMNELEHFCQLGYPLLLATSRKRFIGAVLDLPPEERT
EGTGATVCLGIQKGSAMVRVHDVKEIARMAKMMDAMLNKGGAYHR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaagtgataaagcagcctaaagtcatacaagccaagcaccacacccttagt
tatgaagaaaagacattggtcatgggcattttaaatgtcacacctgactctttttcagat
ggaggaaagtttaatcaagtggataaagcgctggctcatgcagcacagctgatagaggac
ggggcacatatcattgatataggcggagaatcgactcgcccaggagcggcatttgtctca
gaacaagaagagctttcaagagtcattcccgtcatcgaaaagatcacaaaagaattggat
gttccaatttctattgatacgtataaagctcatgtagcagatgaagcagtgaaagctgga
gcttccatcattaatgatgtatggggagcgaaggcagatcctcaaatggcgcacgtagca
gcgaagcacaatgtgccaattattttaatgcacaatcggccagaacgaaattacacacat
ctaatttcagatatgatcgcagatttgaatgaaagtgttcaaattgcaaaacaagcgggt
gtccgtgatgacatgatcatattagacccaggtatagggtttgcgaaaaataaagaggac
aacctgatggtcatgaatgagcttgaacatttttgtcagctcgggtatccactgctctta
gctacatctcgaaaacgattcatcggagctgtcttagacctgccaccggaagagcgtact
gaaggaacgggggcgacggtctgccttggaattcaaaaaggcagtgcgatggttcgggta
catgatgtaaaagaaatcgcaagaatggcaaaaatgatggatgccatgctgaataaggga
ggcgcttatcatcgataa

DBGET integrated database retrieval system