KEGG   Bacillus pumilus: BPUM_0061Help
Entry
BPUM_0061         CDS       T00599                                 

Gene name
sul
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bpu  Bacillus pumilus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bpu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64823..65680
Genome map
AA seq 285 aa AA seqDB search
MTQQVIKQPKVIQAKHHTLSYEEKTLVMGILNVTPDSFSDGGKFNQVDKALAHAAQLIED
GAHIIDIGGESTRPGAAFVSEQEELSRVIPVIEKITKELDVPISIDTYKAHVADEAVKAG
ASIINDVWGAKADPQMAHVAAKHNVPIILMHNRPERNYTHLISDMIADLNESVQIAKQAG
VRDDMIILDPGIGFAKNKEDNLMVMNELEHFCQLGYPLLLATSRKRFIGAVLDLPPEERT
EGTGATVCLGIQKGSAMVRVHDVKEIARMAKMMDAMLNKGGAYHR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaagtgataaagcagcctaaagtcatacaagccaagcaccacacccttagt
tatgaagaaaagacattggtcatgggcattttaaatgtcacacctgactctttttcagat
ggaggaaagtttaatcaagtggataaagcgctggctcatgcagcacagctgatagaggac
ggggcacatatcattgatataggcggagaatcgactcgcccaggagcggcatttgtctca
gaacaagaagagctttcaagagtcattcccgtcatcgaaaagatcacaaaagaattggat
gttccaatttctattgatacgtataaagctcatgtagcagatgaagcagtgaaagctgga
gcttccatcattaatgatgtatggggagcgaaggcagatcctcaaatggcgcacgtagca
gcgaagcacaatgtgccaattattttaatgcacaatcggccagaacgaaattacacacat
ctaatttcagatatgatcgcagatttgaatgaaagtgttcaaattgcaaaacaagcgggt
gtccgtgatgacatgatcatattagacccaggtatagggtttgcgaaaaataaagaggac
aacctgatggtcatgaatgagcttgaacatttttgtcagctcgggtatccactgctctta
gctacatctcgaaaacgattcatcggagctgtcttagacctgccaccggaagagcgtact
gaaggaacgggggcgacggtctgccttggaattcaaaaaggcagtgcgatggttcgggta
catgatgtaaaagaaatcgcaagaatggcaaaaatgatggatgccatgctgaataaggga
ggcgcttatcatcgataa

DBGET integrated database retrieval system