KEGG   Bacillus pumilus: BPUM_0063Help
Entry
BPUM_0063         CDS       T00599                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bpu  Bacillus pumilus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bpu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
66032..66535
Genome map
AA seq 167 aa AA seqDB search
MNNTAYIALGSNIGKKETYLKEAVKKLHEHPEVQVESISSIYETTPVGYENQDDFLNMAV
KISTSLRPNELLALTQKIEQELGRTREVRWGPRTADLDILLYNRENIETEQLVVPHPRMY
ERLFVLVPMSEICPEIGEVQINAVTDQEGVSIWKKTCGVEEFVHTES
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataccgcatacattgctttaggttcgaacatagggaaaaaggaaacttattta
aaagaagccgtcaaaaaactacacgaacatccagaggttcaagtagaatcgatctcttct
atatatgaaacaacacctgtaggttacgaaaaccaagatgactttttaaatatggctgtg
aaaatttccacctcgcttcgtccaaatgaattactggcacttactcagaaaatcgagcaa
gagttaggcagaacgagagaagtgagatggggaccacgaacggctgaccttgacatttta
ctttataatcgtgaaaatattgaaacagaacagctcgtagtgccacatcctagaatgtac
gaacgtttattcgttctcgttccgatgagtgagatttgcccggaaatcggcgaagtacaa
ataaatgccgtaacagaccaagaaggtgtaagcatatggaaaaagacgtgtggggtagaa
gaattcgtgcataccgaaagctaa

DBGET integrated database retrieval system