KEGG   Bacillus pumilus SAFR-032: BPUM_0064Help
Entry
BPUM_0064         CDS       T00599                                 

Definition
(GenBank) XRE family transcriptional regulator
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_31 HTH_19 HTH_25 HTH_26 HTH_23 HTH_37 Sigma70_r4
Motif
Other DBs
NCBI-ProteinID: ABV60764
UniProt: A8F947
Position
89888..90121
Genome map
AA seq 77 aa AA seqDB search
MEKDVWGRRIRAYRKLKGYTQEGFAKRLGISVSVLGEIERGNRLPTNQLVGQIADALNIT
VEELSPNLEEERRGNDV
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagacgtgtggggtagaagaattcgtgcataccgaaagctaaaagggtatact
caggaagggttcgcgaaaagacttggcatctctgtctctgtcttaggagaaattgagcgg
ggcaatcgattaccaacaaaccaattggttggtcaaatagcagatgctttaaatataacg
gtggaagaactttcaccaaatcttgaagaagaaaggaggggaaatgatgtttaa

DBGET integrated database retrieval system