KEGG   Bacillus pumilus: BPUM_0077Help
Entry
BPUM_0077         CDS       T00599                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bpu  Bacillus pumilus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bpu00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
85845..87296
Genome map
AA seq 483 aa AA seqDB search
MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIEDTDQKRNVEGGEESQL
RHLQWLGIDWDESIDKDGGYGPYRQSERNDIYKKYYDELLEKDLAYKCYCTAEELEEERE
AQIARSEMPRYSGKCSHLSKEEEDKLIAEGREPSIRFRVPKGEIIKFDDMVKGEISFETD
GIGDFVIVKKDGTPTYNFAVAVDDHLMKMTHILRGEDHISNTPKQIMIFNAFGWDVPLFG
HMTLIVNENRKKLSKRDESIIQFIEQYKNLGYLPEALFNFIALLGWSPVGEEELFTKEQF
IDIFDVNRLSKSPALFDMHKLKWVNNQYVKALDLDQVVALTLPHLQKAGKVSEQLSDEKN
TWVRKLIALYHEQLSYGAEIVELTELFFKEQIEYNQEAKEVLAEEQVPEVMASFAGQLER
LESFTPDEIKAAIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELLGKETVLNRI
KQI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagtgcgtgttcgttatgcaccgagtccaactggtcatttacatattggg
aatgctagaacggctcttttcaactatttgttcgcacgcagtcaaggcggcaaatttatt
attcgaatcgaagatacggatcaaaagcgtaatgtagaaggcggagaagaaagccagctt
cgccacctgcaatggctcggtattgattgggatgagagcattgataaagatggtggctac
ggtccttacagacaatcagagcgtaatgatatttataaaaagtattatgatgagctgcta
gagaaggacttggcgtataagtgctattgtacggctgaagagctagaggaagagcgtgaa
gcacaaatcgcccgcagtgaaatgcctcgatattctggtaaatgcagtcatttatcgaaa
gaagaagaggacaagctaatcgctgaaggaagagagccaagtatccgcttccgtgtgcca
aaaggagaaatcatcaaatttgacgacatggtcaaaggcgaaatttcatttgagacagac
ggcatcggtgactttgtcattgtgaagaaagatggtacgccgacttataacttcgctgta
gcagtggatgatcatttgatgaagatgactcacattctccgcggagaggatcacatttcg
aatacgcctaaacaaatcatgatcttcaatgcatttggctgggatgttccgctatttgga
catatgacgctgattgtgaacgagaaccgcaagaaattaagcaagcgtgatgaatccatt
attcaattcatcgagcaatataaaaacttgggctatttaccagaagccctgttcaacttc
attgcactacttggatggtctccagtgggcgaagaagaactgtttacgaaagagcaattc
atcgacattttcgatgtgaaccgactttctaagtcaccagctctattcgatatgcataaa
ctaaaatgggtaaataaccaatacgtgaaagcacttgatcttgatcaggttgttgcgcta
acacttccacatcttcaaaaagcaggcaaagtaagtgagcagctgtcagatgaaaaaaac
acgtgggtgcgcaagctgattgctctgtatcatgaacaattaagctatggagcagaaatt
gttgagttaacagagttgttctttaaggagcaaattgagtataatcaagaggcaaaggaa
gttctagcagaggagcaagtaccagaagtcatggcatcatttgctggtcagcttgaacga
cttgagtctttcacacctgatgaaatcaaggcggctattaaagcggtccaaaaagaaaca
gggcataaaggcaagaaactattcatgccaattcgtgtggctgtcacaggacaaacgcac
ggtccagaacttccgcaaagtattgaactactaggtaaagaaacggtattaaaccgcatt
aaacaaatataa

DBGET integrated database retrieval system