KEGG   Bacillus pumilus SAFR-032: BPUM_0154Help
Entry
BPUM_0154         CDS       T00599                                 

Gene name
ybbD
Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BPUM_0154 (ybbD)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BPUM_0154 (ybbD)
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BPUM_0154 (ybbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(149355..151274)
Genome map
AA seq 639 aa AA seqDB search
MLKALFPAALVLALLTSSIPTEKVSSAPLPTAKQMVQNMSLDEKIGQMLMPDFRNWQTKD
ESTPTGFTKMNKEVSHLVEKYHLGGVILFAENVVDTKQTVKLTHEFQKASPKIPLLISID
QEGGIVTRLQKGTHFPGNMSIGASRSKKNAYDTGKIIGKELNTLGINTNFSPVLDVNNNP
NNPVIGVRSFSSDPALVTRLGLQTMKGLQKEKTISTLKHFPGHGDTAVDSHYGLPLVEHD
LDRLKKVELYPFQQAINAGADMVMTAHVQFPAIDDTTYKSKKDGEEIMVPATLSKKVITN
LLKEEMGFQGVVVTDALNMKAIADNFGQEEAVVMAIKAGVDIALMPAPVTSLKTEKNLEN
VFNAVKQAIVKKEIPMSQINESVEKILQLKIKRGIISSKKPMTLEKKIKKATQVVGKKSH
RKAEQKMAREGITLLKNNNKTLPFKPKKNDKILVMAPYEDQTKAMSVTIDSLIKQKKIKP
VRIQSYAFADKSFNKETAKLIQDADYVITGSYVVQNDPAVNDGVIDDNVQDPKKWATAFP
RAVMKEAAAQNKKMVVMSLRNPYDAANFEEADALLAVYGFKGYSNGQFNQPNIPAGLEVI
FGTASPKGKLPVDIPSVTHQNQTLYPFGYGLNLKGKQIK
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagcactgttccccgctgctttggttttagcactgctcacctcttctattcca
acggagaaggtaagctctgcccctcttccaaccgcaaaacaaatggtacaaaacatgtct
ttggatgaaaagataggccaaatgctcatgccagactttcgtaattggcaaacaaaagat
gaatccacacctacaggcttcactaagatgaataaagaagtgtcacaccttgtagaaaaa
tatcatctaggcggtgtcatcttatttgctgagaatgttgttgatacgaaacaaaccgtc
aaactcacccatgaatttcaaaaagcatcaccaaagattccattactcatttcaattgat
caagaaggtggaatcgtcacaagattacaaaagggaacacatttcccaggaaatatgtcg
attggtgcctctagaagcaagaaaaatgcatacgacacagggaaaatcattggtaaagaa
ttaaacacactagggatcaatacaaacttctctcctgtgctagatgtgaataataaccca
aacaaccccgtcattggtgtccgttcctttagctctgatcctgctcttgtcacaaggctt
ggtcttcaaaccatgaagggacttcaaaaggagaagacgatttcgacactcaagcatttc
ccgggacatggtgatacagcagtcgatagtcactatggcttgccgctcgtagaacatgat
ctagatcgtctaaaaaaagtggagctgtatccgtttcaacaagcgatcaacgctggtgcg
gatatggtcatgaccgctcatgttcaatttcctgctattgatgatacaacgtataaaagc
aaaaaagatggcgaggaaattatggttccagcaaccttatcgaaaaaagtcatcacaaat
ttattaaaagaagagatgggctttcaaggagttgtcgtaacagacgccctaaacatgaaa
gcgattgcagataacttcggacaggaggaagctgtagtgatggccattaaggctggcgtc
gacatcgccctcatgccagcaccagtcacctctcttaaaacagagaaaaatcttgagaat
gtgttcaatgcggtaaaacaggcaattgtaaaaaaagaaatcccgatgtctcaaatcaac
gaatctgttgaaaaaattcttcaattgaagatcaaacgtggcatcatctcttcaaaaaaa
cctatgacccttgagaaaaaaatcaaaaaagccactcaagtcgttgggaaaaaatcgcac
cggaaagcagaacaaaaaatggcacgtgaagggatcaccctgcttaaaaacaacaataag
accctacccttcaaacctaaaaagaatgacaagatcttggttatggcaccttacgaagat
cagacaaaagccatgtctgtcacaattgactctctgattaaacagaaaaagatcaagcct
gtacgtatccaatcatatgcttttgcggataagtccttcaacaaagaaacagccaaactc
atacaagacgctgactatgtgattacaggatcttacgttgtccaaaatgacccagctgtg
aatgatggtgtcattgatgataatgtacaggacccgaaaaaatgggcgactgctttccca
cgtgctgtcatgaaagaagctgccgcacaaaacaaaaaaatggtcgtcatgagcctaaga
aacccttacgatgcggcaaattttgaggaggcggatgccttactagctgtttacggtttt
aaaggctattcaaacggacaattcaaccagccaaatatacctgctggattagaagtcata
tttggcactgcatcacctaaaggcaaactgcctgtagatatcccatctgtcactcatcaa
aatcaaaccctgtatccattcggctatggactcaacttgaaagggaaacagatcaaatag

DBGET integrated database retrieval system