KEGG   Bacillus pumilus: BPUM_0154Help
Entry
BPUM_0154         CDS       T00599                                 

Gene name
ybbD
Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpu  Bacillus pumilus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpu00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bpu00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(149355..151274)
Genome map
AA seq 639 aa AA seqDB search
MLKALFPAALVLALLTSSIPTEKVSSAPLPTAKQMVQNMSLDEKIGQMLMPDFRNWQTKD
ESTPTGFTKMNKEVSHLVEKYHLGGVILFAENVVDTKQTVKLTHEFQKASPKIPLLISID
QEGGIVTRLQKGTHFPGNMSIGASRSKKNAYDTGKIIGKELNTLGINTNFSPVLDVNNNP
NNPVIGVRSFSSDPALVTRLGLQTMKGLQKEKTISTLKHFPGHGDTAVDSHYGLPLVEHD
LDRLKKVELYPFQQAINAGADMVMTAHVQFPAIDDTTYKSKKDGEEIMVPATLSKKVITN
LLKEEMGFQGVVVTDALNMKAIADNFGQEEAVVMAIKAGVDIALMPAPVTSLKTEKNLEN
VFNAVKQAIVKKEIPMSQINESVEKILQLKIKRGIISSKKPMTLEKKIKKATQVVGKKSH
RKAEQKMAREGITLLKNNNKTLPFKPKKNDKILVMAPYEDQTKAMSVTIDSLIKQKKIKP
VRIQSYAFADKSFNKETAKLIQDADYVITGSYVVQNDPAVNDGVIDDNVQDPKKWATAFP
RAVMKEAAAQNKKMVVMSLRNPYDAANFEEADALLAVYGFKGYSNGQFNQPNIPAGLEVI
FGTASPKGKLPVDIPSVTHQNQTLYPFGYGLNLKGKQIK
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagcactgttccccgctgctttggttttagcactgctcacctcttctattcca
acggagaaggtaagctctgcccctcttccaaccgcaaaacaaatggtacaaaacatgtct
ttggatgaaaagataggccaaatgctcatgccagactttcgtaattggcaaacaaaagat
gaatccacacctacaggcttcactaagatgaataaagaagtgtcacaccttgtagaaaaa
tatcatctaggcggtgtcatcttatttgctgagaatgttgttgatacgaaacaaaccgtc
aaactcacccatgaatttcaaaaagcatcaccaaagattccattactcatttcaattgat
caagaaggtggaatcgtcacaagattacaaaagggaacacatttcccaggaaatatgtcg
attggtgcctctagaagcaagaaaaatgcatacgacacagggaaaatcattggtaaagaa
ttaaacacactagggatcaatacaaacttctctcctgtgctagatgtgaataataaccca
aacaaccccgtcattggtgtccgttcctttagctctgatcctgctcttgtcacaaggctt
ggtcttcaaaccatgaagggacttcaaaaggagaagacgatttcgacactcaagcatttc
ccgggacatggtgatacagcagtcgatagtcactatggcttgccgctcgtagaacatgat
ctagatcgtctaaaaaaagtggagctgtatccgtttcaacaagcgatcaacgctggtgcg
gatatggtcatgaccgctcatgttcaatttcctgctattgatgatacaacgtataaaagc
aaaaaagatggcgaggaaattatggttccagcaaccttatcgaaaaaagtcatcacaaat
ttattaaaagaagagatgggctttcaaggagttgtcgtaacagacgccctaaacatgaaa
gcgattgcagataacttcggacaggaggaagctgtagtgatggccattaaggctggcgtc
gacatcgccctcatgccagcaccagtcacctctcttaaaacagagaaaaatcttgagaat
gtgttcaatgcggtaaaacaggcaattgtaaaaaaagaaatcccgatgtctcaaatcaac
gaatctgttgaaaaaattcttcaattgaagatcaaacgtggcatcatctcttcaaaaaaa
cctatgacccttgagaaaaaaatcaaaaaagccactcaagtcgttgggaaaaaatcgcac
cggaaagcagaacaaaaaatggcacgtgaagggatcaccctgcttaaaaacaacaataag
accctacccttcaaacctaaaaagaatgacaagatcttggttatggcaccttacgaagat
cagacaaaagccatgtctgtcacaattgactctctgattaaacagaaaaagatcaagcct
gtacgtatccaatcatatgcttttgcggataagtccttcaacaaagaaacagccaaactc
atacaagacgctgactatgtgattacaggatcttacgttgtccaaaatgacccagctgtg
aatgatggtgtcattgatgataatgtacaggacccgaaaaaatgggcgactgctttccca
cgtgctgtcatgaaagaagctgccgcacaaaacaaaaaaatggtcgtcatgagcctaaga
aacccttacgatgcggcaaattttgaggaggcggatgccttactagctgtttacggtttt
aaaggctattcaaacggacaattcaaccagccaaatatacctgctggattagaagtcata
tttggcactgcatcacctaaaggcaaactgcctgtagatatcccatctgtcactcatcaa
aatcaaaccctgtatccattcggctatggactcaacttgaaagggaaacagatcaaatag

DBGET integrated database retrieval system