KEGG   Bacillus pumilus SAFR-032: BPUM_0159Help
Entry
BPUM_0159         CDS       T00599                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00220  Arginine biosynthesis
bpu00330  Arginine and proline metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01130  Biosynthesis of antibiotics
bpu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BPUM_0159
   00330 Arginine and proline metabolism
    BPUM_0159
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BPUM_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABV60858
UniProt: A8F9E1
Position
180007..180918
Genome map
AA seq 303 aa AA seqDB search
MGEQKKVTLVGVPMDLGQMRRGVDMGPSAIRCAGVKEKLESLSFGVEDLGDIPVEQRDDE
KGLYTSEKLKNLTENAGANQLLAEKVDSIVQSGSFPLILGGDHSIAIGTLAGVSKHYENL
GVIWYDAHGDLNTEETSPSGNIHGMPLAVSLGLGHADLTNIGGYSPKLKPENVVLIGARS
LDEGERALIREKGIKVYTMHEIDRLGMTRVMEEAISYLKERTDGVHLSLDLDGLDPAECP
GVGTPVAGGISYRESHLAMELLEEAGILTSAEFVEVNPVLDEKNKTAEAAVALIGSLMGE
KLL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggagagcaaaagaaagtcacacttgtcggggttccaatggatttgggtcagatgaga
aggggtgtcgacatgggaccgagtgcgattcggtgtgcaggcgtaaaagaaaaattggaa
tcgctttcatttggagtggaagatctcggagatattccggttgaacaaagagatgatgaa
aagggtttatatacaagtgaaaagctaaaaaatttaacggagaatgctggtgcgaatcag
ctgctggctgagaaggttgacagtattgtgcaatcaggctcattcccgctcattttaggc
ggtgatcacagcattgccattggcacacttgcgggagtatccaagcactatgaaaactta
ggtgtcatttggtatgatgcacacggtgatttaaatacagaggagacctctccttctgga
aatatacatggtatgccgcttgcagtcagtcttggccttggtcatgctgatttgacgaac
attggtggttattctccaaaattgaagcctgagaatgttgttttaattggtgctagatcc
ttagatgaaggagaacgggcattgattagagagaaaggtattaaagtgtatacgatgcat
gaaatagatcgtttagggatgacaagggtgatggaggaggccatttcatatttaaaggaa
agaacggatggtgtccacctgtcacttgatttagatggattagatccagccgagtgtcca
ggtgttggaactcctgtggcaggaggcatcagttaccgggagagtcatctagccatggag
cttttagaggaagcgggtattttgacttcagctgaatttgttgaggtgaatccggttttg
gatgaaaaaaataaaacagccgaagcagctgttgcgttgattggttcgttaatgggcgaa
aagctattgtag

DBGET integrated database retrieval system