KEGG   Bacillus pumilus: BPUM_0159Help
Entry
BPUM_0159         CDS       T00599                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bpu  Bacillus pumilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
156606..157517
Genome map
AA seq 303 aa AA seqDB search
MGEQKKVTLVGVPMDLGQMRRGVDMGPSAIRCAGVKEKLESLSFGVEDLGDIPVEQRDDE
KGLYTSEKLKNLTENAGANQLLAEKVDSIVQSGSFPLILGGDHSIAIGTLAGVSKHYENL
GVIWYDAHGDLNTEETSPSGNIHGMPLAVSLGLGHADLTNIGGYSPKLKPENVVLIGARS
LDEGERALIREKGIKVYTMHEIDRLGMTRVMEEAISYLKERTDGVHLSLDLDGLDPAECP
GVGTPVAGGISYRESHLAMELLEEAGILTSAEFVEVNPVLDEKNKTAEAAVALIGSLMGE
KLL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggagagcaaaagaaagtcacacttgtcggggttccaatggatttgggtcagatgaga
aggggtgtcgacatgggaccgagtgcgattcggtgtgcaggcgtaaaagaaaaattggaa
tcgctttcatttggagtggaagatctcggagatattccggttgaacaaagagatgatgaa
aagggtttatatacaagtgaaaagctaaaaaatttaacggagaatgctggtgcgaatcag
ctgctggctgagaaggttgacagtattgtgcaatcaggctcattcccgctcattttaggc
ggtgatcacagcattgccattggcacacttgcgggagtatccaagcactatgaaaactta
ggtgtcatttggtatgatgcacacggtgatttaaatacagaggagacctctccttctgga
aatatacatggtatgccgcttgcagtcagtcttggccttggtcatgctgatttgacgaac
attggtggttattctccaaaattgaagcctgagaatgttgttttaattggtgctagatcc
ttagatgaaggagaacgggcattgattagagagaaaggtattaaagtgtatacgatgcat
gaaatagatcgtttagggatgacaagggtgatggaggaggccatttcatatttaaaggaa
agaacggatggtgtccacctgtcacttgatttagatggattagatccagccgagtgtcca
ggtgttggaactcctgtggcaggaggcatcagttaccgggagagtcatctagccatggag
cttttagaggaagcgggtattttgacttcagctgaatttgttgaggtgaatccggttttg
gatgaaaaaaataaaacagccgaagcagctgttgcgttgattggttcgttaatgggcgaa
aagctattgtag

DBGET integrated database retrieval system