KEGG   Bacillus pumilus SAFR-032: BPUM_0511Help
Entry
BPUM_0511         CDS       T00599                                 

Gene name
dck
Definition
deoxynucleoside kinase (EC:2.7.1.145)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BPUM_0511 (dck)
   00240 Pyrimidine metabolism
    BPUM_0511 (dck)
Enzymes [BR:bpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BPUM_0511 (dck)
    2.7.1.76  2'-deoxyadenosine kinase
     BPUM_0511 (dck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(547179..547838)
Genome map
AA seq 219 aa AA seqDB search
MNNIEIPKDAVITIAGTVGVGKSTMTKTIADKLGFQTSLEKVDDNPYLEPFYSDFQRWSF
HLQVYFLAERFKEQKRIFESGGGYVQDRSIYEDTGIFAKMHADKGTMSEVDYETYTSLFE
AMVMTPYFPHPDVLIYLHGDLNHILHRIEERGREMETQTDRAYWEEMYTRYTEWIEQFDL
CPVIKINIEDYDLLHDESSLDPILHEIASVIQKNRSKTK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatatcgaaataccaaaagatgcagtgatcacaattgccgggactgttggtgtc
ggaaaatcaactatgactaaaacgatagcggacaagctaggctttcaaacctctcttgaa
aaagtagatgataacccatacttagagcccttttattctgattttcaaagatggagcttc
catttacaagtctatttccttgcggagcgttttaaggaacaaaagcggatttttgaatct
ggtggaggatatgtgcaagatcgttcaatttatgaggacacgggcatattcgcaaaaatg
catgcggacaaaggtacgatgtctgaagtagattatgaaacgtatacaagtctattcgag
gcaatggtgatgacaccttacttccctcaccctgatgttctcatctatttacacggggat
ttaaatcatattttacatcgtatcgaggaacgcggcagagagatggaaactcaaacggac
cgagcctattgggaagaaatgtacactcgatacacagaatggatcgaacaattcgattta
tgtccagtgattaaaattaacattgaagattacgacttacttcatgatgaaagctcactt
gatcccattcttcatgaaatagcttctgtcattcaaaaaaatcgctctaaaacaaaataa

DBGET integrated database retrieval system