KEGG   Bacillus pumilus SAFR-032: BPUM_0513Help
Entry
BPUM_0513         CDS       T00599                                 

Definition
(GenBank) spore gernimation protein
  KO
K06306  spore germination protein
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_18 LysM Glyco_hydro_85
Motif
Other DBs
NCBI-ProteinID: ABV61208
UniProt: A8FAE1
Position
complement(26095..27396)
Genome map
AA seq 433 aa AA seqDB search
MTIQIYVVKRGDTLNEIAMRFKTTVNEIIRTNDIETPNQLVIGQTIVIPIRGQFYEVKQN
DTLYQIGRRFRISVEELARVNRIRPEAILPIRFLLYIPQRPKRNINSNAYIEPRGNQVSE
NLKQAAREASPYLTHLGAFSFQAQRDGTLKEPPLDQLPQIAAQSRTVLSMVVTNLENDKF
SDELGRILLNNQSVKATFLNEIVRIAKKYQFKEIHFDFEYLRPADKEAYIQFLREATTRF
HQEGWTISVALAPKTSSQQKGKWYEAHDYGAIGNIVDHVVLMTYEWGYSGGPAQAVSPIG
PVREVIEYALTVMPANKIVMGQNLYGYDWTLPYVQGGPIAKAVSPQQAIAIARNNNASIL
YDETAQAPYFRYTDANNKEHEVWFEDARSIQAKFNLIKELSLNGIAYWKLGLSFPQNWLL
LSDQFNIEKRTTS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttgactattcaaatttatgttgtcaaaagaggagatactttaaacgaaattgccatgcgt
tttaaaacaacagtcaatgaaatcatccggaccaacgatattgaaacaccaaatcaactc
gtcattggacaaacaattgtcattccaattagaggacaattttatgaggtcaaacaaaat
gacacactttatcaaattggaaggcgatttcgaatttcagtagaagagctggcacgtgtg
aatagaatacggcctgaagccatacttcctattcgcttcttgctctatattcctcaaaga
cctaaaaggaacattaattcgaatgcttacattgaaccacggggaaatcaagtgagtgaa
aacttaaaacaagcagctagagaggcctctccatatttaacgcatttaggcgcttttagt
ttccaagcgcaaagagatggaacactgaaagaaccaccattagatcagctacctcaaata
gccgctcaaagcagaactgttttatccatggtggtgactaatctagagaatgataaattc
agtgatgaacttgggcgaattcttttgaataaccaatctgtcaaagccacatttttaaat
gaaatcgttcgtattgcaaaaaagtatcaatttaaagaaatccattttgattttgaatat
ttacgccccgctgataaagaggcttacattcaatttttaagagaggcaacgacccgcttc
catcaagaaggatggacaatatctgttgcacttgcccctaaaacaagtagtcagcaaaag
ggaaaatggtatgaggctcatgactatggagctattgggaatatcgtcgatcatgttgtc
ttaatgacctacgaatggggatacagcggcggccctgcgcaagcagtctctcccattgga
cctgtccgcgaagtcattgaatatgcactgaccgttatgccagccaataaaattgttatg
ggccagaacttatacggctatgattggacgcttccttacgttcaaggcgggcctatcgct
aaagctgtcagtccccaacaagcgattgccattgctagaaataataatgcctccattcta
tatgacgaaacagctcaagcaccttattttcgttatacagatgccaataataaagagcac
gaagtatggttcgaagatgctagatcgattcaagcaaagttcaacctcatcaaagagtta
agcttgaacgggattgcttattggaaattaggtctatccttccctcaaaattggctctta
ttatcagatcaatttaatattgaaaaaagaacgacatcgtaa

DBGET integrated database retrieval system